KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0907Help
Entry
I33_0907          CDS       T01837                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of acetoincleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00010  Glycolysis / Gluconeogenesis
bsr00020  Citrate cycle (TCA cycle)
bsr00620  Pyruvate metabolism
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01120  Microbial metabolism in diverse environments
bsr01130  Biosynthesis of antibiotics
bsr01200  Carbon metabolism
Module
bsr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I33_0907
   00020 Citrate cycle (TCA cycle)
    I33_0907
   00620 Pyruvate metabolism
    I33_0907
Enzymes [BR:bsr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     I33_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 HlyD_D23 Biotin_lipoyl_2 PYNP_C RnfC_N GCV_H DUF2118
Motif
Other DBs
NCBI-ProteinID: AEP89899
Position
859230..860426
Genome map
AA seq 398 aa AA seqDB search
MAVKVVMPKLGMAMKQGEVSIWNKKVGDPVEKGESIASIQSEKIEMEIEAPEKGTLIDIK
VKEGEEVPPGTAICYIGDANESVQEEAGAPVAEDNMPQAVQPVKQENKPAASKKDRMKIS
PVARKIAEKAGLDLKQLKGTGPGGRIVKDDVTKALAEQKKDQAKPVSEQKAQEIPVTGMR
KVIAARMQESLANSAQLTITMKADITKLATLQKQLSPTAEERYGTKLTITHFVSRAAVLA
LQAHPVLNSLYQNERIITHPHVHLGMAVALENGLVVPVIRHAEKLSLIELAQSISENAKK
AREGRAGSEELQGSTFSITNLGAFGVEHFTPILNPPETGILGIGASYDTPVYLGEEIVRS
TILPLSLTFDHRACDGAPAATFLKAIKTYLEEPAALIL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaaaagtagtgatgccaaaattaggaatggccatgaaacaaggggaagtatcg
atatggaataaaaaagtaggcgacccggttgaaaagggagaaagcattgccagcattcaa
tcggagaaaattgaaatggagatcgaagcgcctgaaaaaggaacgctgatcgatattaaa
gtgaaagagggagaagaggttccgcccggcacagctatctgctatatcggggacgccaat
gagtcggtgcaggaagaggcgggggcgcctgttgctgaagacaatatgccgcaagccgtt
cagcccgtcaaacaagaaaacaaacccgcagcctccaaaaaagatcgaatgaaaatatct
ccagtcgccagaaaaatagcagaaaaagcaggattagacctaaaacaactgaaaggaact
ggaccaggcggacgaatcgtgaaggatgacgtaacaaaggcccttgctgaacagaaaaaa
gatcaggcaaagcctgtgtcggagcagaaagcgcaggaaatcccggtgacaggcatgaga
aaagtcatcgctgcccgaatgcaggaaagcttggcaaacagcgcgcagctgacgatcacg
atgaaagctgatatcaccaagcttgccactcttcaaaaacagctttcaccaactgcggaa
gagagatacggcacaaaactgacgatcactcattttgtctcaagagccgccgttctcgct
ctgcaagctcaccctgtgctgaacagcctttatcaaaatgagcgcatcatcacacatccc
catgtgcaccttggtatggctgtagccttggaaaatggcttagtggtgcctgtcatccgc
catgctgaaaagctatcgctgattgaactggctcaatccatctcagaaaatgccaaaaaa
gcacgcgaggggcgtgcgggaagcgaagaactgcaaggctctaccttctccattacaaac
cttggcgcgtttggagttgagcatttcacaccgattctaaatccgccggaaacaggcatt
ctcggcatcggagcaagctatgacacaccggtgtacctaggagaagagatcgtcagaagc
acgatcctgccgctcagcctgacatttgatcacagagcgtgtgacggcgcccctgccgct
acattcctgaaggcgattaaaacatatttggaagaacccgcagcattaattttatag

DBGET integrated database retrieval system