KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1056Help
Entry
I33_1056          CDS       T01837                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bsr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
981009..982499
Genome map
AA seq 496 aa AA seqDB search
METYILSLDQGTTSSRAILFNKEGKIVHSAQKEFTQYFPHPGWVEHNANEIWGSVLAVIA
SVISESGISASQIAGIGITNQRETTVVWDKDTGSPVYNAIVWQSRQTSGICEELREKGYN
DKFREKTGLLIDPYFSGTKVKWILDNVEGAREKAEKGELLFGTIDTWLIWKMSGGKAHVT
DYSNASRTLMFNIYDLKWDDELLDILGVPKSMLPEVKPSSHVYAETVDYHFFGKNIPIAG
AAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAIKSEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGLRMFQDSSLSESYAEKVDSTDGVYVVPAFVGLGTPYWDSDVR
GSVFGLTRGTTKEHFIRATLESLAYQTKDVLDAMEADSNISLKTLRVDGGAVKNNFLMQF
QGDLLNVPVERPEINETTALGAAYLAGIAVGFWKDRSEIANQWNLDKRFEPKLEEEKRNE
LYKGWQKAVKAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgtacattttatccttagatcaggggacgacaagttcaagagcgattctgttt
aataaagaaggcaaaatcgttcactctgctcaaaaggaatttacacaatacttcccgcat
ccaggctgggttgagcataatgccaatgaaatttggggctctgtcctcgcggttatcgcc
tcagtcatctctgaatcaggaatcagcgcttctcaaattgccggcatcggcatcacgaac
cagcgcgagacgacggttgtgtgggataaagatacaggaagtcctgtctataatgcaatc
gtttggcagtccagacagacgtccggcatttgtgaggaacttcgtgaaaaaggatataat
gataaattcagagaaaaaaccgggcttttaatcgatccatacttctccggcacgaaggtg
aagtggattttagacaatgtggaaggcgcaagagaaaaagcggaaaaaggcgagctgctg
tttggaacgattgatacgtggctcatttggaaaatgtcaggcggaaaagcgcatgtgacc
gattactccaatgcttcaagaacactgatgtttaatatttacgatttaaaatgggacgat
gaactgctcgacattctaggcgtaccgaaatccatgctccctgaagtgaagccgtcttcc
catgtgtatgcggagactgttgattatcacttcttcggaaaaaatatcccgattgcggga
gcggcaggcgaccagcagtccgcattgttcggccaggcatgctttgaagaaggcatgggg
aaaaacacatacggcactggatgtttcatgctgatgaatacaggggaaaaagcaattaag
tccgaacacgggcttttgacaacaattgcttggggcattgacggaaaagtgaactatgcg
ttagaaggaagcatttttgtcgctggctctgccatccagtggcttagagacggattgaga
atgttccaggattcatcgcttagcgaatcttatgcagagaaagtggattcaactgacggg
gtgtatgttgttccggcatttgtcggattgggcacaccttactgggacagcgatgtgcgc
ggttcggttttcggcctgaccagagggacaacaaaagagcactttatccgtgcgacactg
gagtcattggcttatcagacaaaagatgtgcttgacgcaatggaagcagattcaaacatt
tcattaaagacgcttcgtgtagacggaggagctgtgaaaaacaatttcctaatgcagttc
caaggagacctgttgaatgttcctgtcgagcgcccggaaattaatgaaacgactgcactt
ggcgcggcttatttggcgggtatcgctgtgggattctggaaggaccgttctgaaatcgcg
aaccagtggaatctggataaacggtttgaacctaaattagaagaagaaaaacgaaatgag
ctgtataaaggctggcaaaaagccgtgaaagcagctatggcttttaaataa

DBGET integrated database retrieval system