KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1146Help
Entry
I33_1146          CDS       T01837                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    I33_1146 (hemG)
Enzymes [BR:bsr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     I33_1146 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1066863..1068275
Genome map
AA seq 470 aa AA seqDB search
MSDGKKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKIAP
FVSTGLFSLSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLVEE
IEKQLKLTKVYKGTKVTKLSRGGSGYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAI
SHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPKGK
TLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGH
KQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggcaaaaaacatgtagtcatcatcggcggcggcattaccggtttagccgcc
gccttctatatggaaaaagaaatcaaagaaaagaatctgccgcttgagctgacacttgtt
gaggcaagtccgagagtcggcgggaaaatccagactgtcaagaaagacggctatatcatc
gaaagagggccagactcatttctggaacgaaagaaaagcgccccgcagcttgttaaggac
ttaggtcttgagcatttgcttgtcaacaatgcgaccggacaatcctatgtgcttgtaaac
cgcaccctgcatccaatgccgaagggtgccgtaatggggataccgacaaaaattgcgccg
tttgtttctacgggtctgttttctttgtctgggaaggcgagagctgctatggatttcatc
ctgcctgcaagcaaaacaaaggatgatcagtcattgggagaattctttcgcagacgtgtc
ggagatgaagtggtcgagaacttaatcgagccgcttctatcagggatctacgcaggcgac
attgacaagctcagcctgatgtcgacattcccgcaattttaccagacggaacaaaagcat
agaagcctgattctcggcatgaaaaaaacaaggccccaaggctcaggccagcaactgacg
gcaaaaaaacaagggcagttccagactctgtcaaccggtttgcagacccttgtagaagag
atcgaaaagcagttaaagctgacgaaggtgtataagggcacaaaagtgaccaagctcagc
cgtggcggctctggctattcgctcgaactggataacggcgtcacacttgatgcagattca
gtaattgtgactgctccgcataaagcggctgcgggaatgctttctgagcttcctgccatt
tctcatttgaaaaatatgcactccacatccgtggcaaacgtcgctttaggcttccctgaa
ggctccgtccaaatggagcatgagggcactggttttgtcatttcaagaaatagtgacttt
gcgatcactgcctgtacgtggacgaataaaaaatggccgcacgcagcgccgaaaggcaaa
acgctgcttcgggcatatgtcggaaaagccggagacgaatccattgtcgatctatcagat
aatgacattatcaacattgtgttagaagacttaaagaaagtcatgaacataaacggcgag
ccggaaatgacatgtgtcacccgatggcatgaaagcatgccgcagtaccatgtcggccat
aagcagcgtatcaaggagctgcgtgaagcacttgcatctgcatatccgggtgtttatatg
acaggcgcttcttttgaaggtgtcggcattcccgactgcattgatcaaggaaaagctgcc
gtgtctgacgcgcttacgtatttattcagctaa

DBGET integrated database retrieval system