KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1162Help
Entry
I33_1162          CDS       T01837                                 

Definition
subtilisin amylosacchariticus (EC:3.4.21.62)
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1083093..1084238)
Genome map
AA seq 381 aa AA seqDB search
MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAMSSAKKKDVIS
EKGGKVQKQFKYVNAAAATLDEKAVKELKQDPSVAYVEEDHIAHEYAQSVPYGISQIKAP
ALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAGTIAA
LNNSIGVLGVAPNASLYAVKVLDSSGSGQYSWIINGIEWAISNNMDVINMSLGGPTGSTA
LKTVVDKAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGS
ELDVMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTA
TYLGNSFYYGKGLINVQAAAQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgagaagcaaaaaattgtggatcagtttgttgtttgcgttaacgttaatctttacgatg
gcgttcagcaacatgtctgcgcaggctgccggaaaaagcagtacagaaaagaagtatatt
gttggatttaaacagacaatgagtgccatgagttccgctaagaaaaaggatgttatttct
gaaaaaggcggaaaggttcaaaagcaatttaaatatgttaacgcagccgcagcaacattg
gatgaaaaagctgtaaaagaattaaagcaagatccgagtgttgcatatgtggaagaagat
catattgcacatgaatatgcgcaatctgttccttacggcatttctcaaattaaagcgccg
gctcttcactctcaaggctacacaggctctaacgtaaaagtagctgttatcgacagcgga
attgactcttctcatcctgacttaaacgtcagaggcggagcaagcttcgtaccttctgaa
acaaacccataccaggacggcagctctcacggtacgcatgtagccggtacgattgccgct
cttaataactcaatcggtgttctgggtgtagcgccaaacgcatcgttatatgcagtaaaa
gttcttgattcatcaggaagcggccaatacagctggattattaacggcattgagtgggcc
atttccaacaatatggatgtcatcaacatgagccttggcggacctactggttctacagcg
ctgaaaacagtcgttgacaaagccgtttccagcggcatcgttgttgccgccgctgccgga
aacgaaggttcgtccggaagcacaagcacagtcggctaccctgcaaaatatccttctacc
attgcggtaggtgcggtaaacagcagcaaccaaagagcttcattctcaagcgcaggttct
gagcttgatgtgatggctcctggcgtatccatccaaagcacacttcctggtggcacttac
ggtgcttacaacggaacatccatggcgactcctcacgttgccggagcagcagcgttaatt
ctttctaagcacccgacttggacaaacgcgcaagtccgtgatcgtttagaaagcactgca
acatatcttggaaactctttctactatggaaaagggttaatcaacgtacaagcagctgca
caataa

DBGET integrated database retrieval system