KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1215Help
Entry
I33_1215          CDS       T01837                                 

Gene name
asnO
Definition
sporulation-specific asparagine synthase AsnO (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I33_1215 (asnO)
Enzymes [BR:bsr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     I33_1215 (asnO)
Peptidases [BR:bsr01002]
 Cysteine Peptidases
  Family C44
   I33_1215 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1135940..1137784
Genome map
AA seq 614 aa AA seqDB search
MCGITGWVDFKKQLVQEKQTMDRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDIEGGR
QPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVDH
LNGIFAFAVWDEKRNLLFAARDRLGVKPFFYTKEGSSFLFGSEIKAILAHPDIKARVDRT
GLSEIFGLGPSRTPGTGIFKGIKEIRPAHALTFSKDGLNIWRYWNVESEKHTDSFDDTVA
NVRSLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKEGKAPLHTYSIDYEEND
KFFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKDLVDHLEEAVLVKDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHTADVESGFPWMRSTEERIKLLSDSWQKK
LNLKEYVNAKYEETLAETPLLDGETGVDKARRQLFYLNMLWFMTNLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWEMKMHDNREKGILRKALEGILPDDILYRKKSPYPKTHHPEY
TKGVSEWLKTIRSQKDSVLHTLLDRKQLDQLLETEGSSFKVPWFGQLMKGPQLIAHLAQI
HTWFEAYRIDIDEG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattacgggttgggtcgattttaaaaagcagctcgtccaggaaaaacaaacg
atggacagaatgacagacactctttccaaacgagggcctgatgattcaaacgtttggggg
gagcaccatgttttattcggacataaaagacttgcggttgttgatattgaaggcgggcgc
cagccgatggcgtgcacctataaaggcgatacgtacaccattatttacaatggcgagctg
tataacacggaagatttgcgcaaagaattgcgggcgcggggccatcaattcgagcgtacg
tcagataccgaggtgcttctgcacagctacattgaatggcaggaagactgtgtcgaccat
ctcaatggcatatttgctttcgctgtgtgggatgaaaagcgtaatctgctgtttgccgcg
agagaccgtctcggcgtaaagccgtttttttacacgaaggaaggctcttcatttctcttc
gggtcggaaatcaaagcaatcctcgcgcaccctgatataaaagcgcgagtggacagaacg
ggactttctgaaattttcggtcttggaccgtccagaaccccgggcactggcatatttaaa
ggcataaaagaaatccgcccggctcacgcgctgacattttccaaagacggacttaatatt
tggcgttattggaatgttgaaagcgaaaaacatacggacagttttgatgacacggttgcc
aatgtcagatcgttatttcaggacgcggtgacgcggcagcttgtgtcggatgtgccggtt
tgcacattcctttcaggcggtctggactcaagcgcaattacagcgattgcggcgggccat
tttgaaaaggaaggaaaagcaccgcttcatacttattcgattgattacgaagagaacgat
aaattttttcaagcaagcgcttttcagccgaatgatgacggaccatggattgaaaaaatg
acagaggctttcggcacaacgcaccacaaatgcgtcatcagccaaaaagatctcgttgat
catttggaggaagctgtactggtcaaagacttgccgggaatggcagatgtcgactcatcc
ctgctgtggttttgccgggaaatcaaaaaggactttgtcgtcagcctatcgggagagtgc
gcggatgagattttcggcgggtacccgtggttccatacggcagatgttgagtctggcttt
ccatggatgagatcaacggaggagcggatcaagctgctttctgattcatggcagaaaaaa
ttgaatctgaaagaatacgtaaatgccaaatatgaagaaaccttggcagaaacgccatta
ttagacggggaaacgggtgtggataaagcaagaagacagctgttctatttaaatatgctt
tggtttatgacgaaccttttggatcggaaggatcgcatgagcatgggggcgagcctggaa
gtgcgggtgccgttcgccgatcaccggcttgtggaatatgtttggaatattccgtgggaa
atgaaaatgcatgataatcgggaaaaaggcattttacgcaaagcgcttgaaggtattttg
cctgatgacattctgtatcgcaaaaaaagcccgtatccgaaaacccatcatccggaatat
acaaaaggcgtcagcgaatggctgaaaacgatcagaagccaaaaggactccgtgctccat
accttgctagacagaaaacaattagatcagcttttagaaacggaaggctcctccttcaag
gtgccgtggttcgggcagctcatgaaggggcctcagctgatcgcccatcttgctcaaatt
catacatggtttgaagcgtatcgcattgatattgatgaaggataa

DBGET integrated database retrieval system