KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1376Help
Entry
I33_1376          CDS       T01837                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    I33_1376
Enzymes [BR:bsr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     I33_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1271136..1271951
Genome map
AA seq 271 aa AA seqDB search
MGKGLHGKRVVIGGSRKTEEISTIIEKQGGTPVIRPLQGTVYLAEKQVEPDLRTFVEGKK
ADWVIFTTGIGLETLVDMAEKIGLKEEFLQAIRQAKAACRGYKTLSALKKLGITPEASDE
DGTTRGLIRSLEPHDFSGKTVMVQLHGEKAPALIAFLEEKGASVVPILPYQHIPPEEETV
ERLCRELMNGEIDAVCFTTAIQVRSLFDFAKRRGYINEVKKVFKERAIAAAVGKVTAEAL
REEGITRLLAPEIERMGAMIVELAKYYEEKE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggattacatggaaagcgcgtggtgatcgggggctcccgaaaaaccgaagaa
atcagcaccatcattgaaaaacagggcggaactcctgtcatccgtcctctccaaggaacg
gtttacttagcagagaagcaggtggagccggatttgcggacgtttgtggagggaaaaaaa
gctgactgggtcattttcacgacaggcatcgggttggagactcttgtcgatatggcagag
aaaatcggtctgaaagaagagtttctgcaggcgattcgtcaggcaaaagcggcatgcagg
gggtacaaaacgctgtctgcgctgaaaaagcttgggatcacaccggaagcttcggatgaa
gacgggacaacaagaggcttaatccgttctttggagcctcacgacttttcaggaaaaaca
gtcatggtgcagcttcatggagaaaaagcgccggctctcatcgcatttcttgaagaaaaa
ggcgcgtctgtcgtgccgattctgccttatcagcacatcccgccggaggaggaaacggtg
gagcggttatgccgagagctgatgaacggtgagatcgatgccgtttgttttacaacggcc
attcaggttcgttccctgtttgattttgctaagaggcgaggttatatcaatgaagtgaag
aaggtattcaaagaacgcgccatcgcagctgctgtcggaaaagtgactgctgaagcactg
cgggaagagggcattacgagactgcttgcgccagagattgagcggatgggtgcgatgatt
gttgagctggccaagtattatgaagaaaaggaataa

DBGET integrated database retrieval system