KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1475Help
Entry
I33_1475          CDS       T01837                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    I33_1475 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    I33_1475 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    I33_1475 (proB)
Enzymes [BR:bsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     I33_1475 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355387..1356484
Genome map
AA seq 365 aa AA seqDB search
MKKQRIVVKIGSSSLTNSKGSIDEAKIREHVQAISVLKKAGHEMILITSGAVAAGFSSLG
YPSRPVTIKGKQAAAAVGQTLLMQQYMNQFKLYSLTPGQILLTRNDFSKRERYRNAYATI
MELLERGVIPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
NPEAKRFDYLPEITPELLGYAGSAGSKVGTGGMKSKLLAAQTALSLGVKVFIGTGSGAQK
LADILDGRGDGTYIGDKELSSVNNTRQWIQFHSPISGEIIIDAGAEEAMIHNGSSLLPAG
VVGVNGSFPKGAVVEVRGPGGVIGKGQTHYSSEEIMEAKGKRSAELDFEKTFEVIHRNDW
VNIKD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaagaatagtagtgaaaataggaagcagttcgctcacgaatagcaaagga
agcattgatgaggcaaaaatcagagagcatgttcaggctatttccgtgttaaaaaaagcg
gggcatgaaatgattctgattacctcgggtgccgtagcggcggggttttccagcctgggt
tatccatcccgtcccgttaccatcaaaggaaaacaggcggccgccgcggtcggacaaaca
ctgttaatgcagcaatatatgaatcaatttaaactatactcactgactccgggacaaatc
cttttaacgagaaatgatttttcgaaaagagaacggtaccgaaacgcgtatgctacgata
atggaattattggaacgcggcgtcattccaattatcaacgagaacgattctacatctgtt
gaagaattgacattcggagataatgatatgctttctgcgttagtcagcggattgattcac
gcggaccagctcatgattctcaccgacattaacggactgtatgatgccaatccgaatgaa
aatcctgaggcgaaacgatttgattatttgccggagatcacgcctgaattgcttggatat
gctggttcagccggatcaaaggtcggcaccggcggaatgaaatcaaagctgttagccgca
caaaccgcgctgtctctgggagtgaaagtattcattggaacaggtagcggggcgcaaaaa
cttgcggacattttggacggcaggggagacggcacttatatcggagacaaagaactatct
tcggttaacaacacaaggcagtggattcagttccactcgccgatatcgggagaaattatc
attgatgcgggtgccgaagaggcgatgatccataatggaagcagccttttgcccgctggc
gttgtgggtgtgaacggaagctttccgaaaggggcggttgtggaagtcaggggaccgggc
ggcgtgatcggcaaaggccaaacccattactcctctgaggagattatggaggccaaaggc
aaacgcagtgccgaacttgattttgagaaaacgtttgaggttattcataggaatgactgg
gtcaatataaaagactag

DBGET integrated database retrieval system