KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1533Help
Entry
I33_1533          CDS       T01837                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC:1.13.-.-)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    I33_1533
Enzymes [BR:bsr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     I33_1533
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     I33_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1407087..1407623
Genome map
AA seq 178 aa AA seqDB search
MATIRIHDEANTTIENQEEVASFLDSQEVIYEQWDITKLPEYLSEKYDLTEEEKQQILDT
FETEIKDISTRRGYKAQDVISLSDSNPKLDELLENFKREHHHTDDEVRFIVSGHGIFVIQ
GKDGTFFDVRLNPGDLISVPENIRHYFTLQEDRKVVAVRIFVTTEGWVPIYEKDSVNQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggctacaattcgaattcatgatgaggcaaatacaacgattgaaaatcaagaggaagtg
gcaagctttctggacagtcaagaggttatttatgagcaatgggatatcacgaagcttccg
gaatatctctcagagaaatatgacctgacagaagaagaaaaacagcaaattcttgatacc
ttcgaaactgaaattaaagatatctcaacccgccgcggctacaaagcacaggatgttatt
tcattgtcagacagcaatccgaaacttgatgaactgcttgaaaactttaaaagagagcat
caccatacagacgatgaggttcgttttattgtaagcggacacggtatttttgtcattcaa
ggcaaggacggcacgttttttgatgtccgtttaaaccctggagatttaatctccgtgcct
gagaatatccgccattacttcacgcttcaggaggaccgcaaagttgtcgcggtgagaatt
tttgtcacaactgaaggctgggttccgatttatgaaaaagacagcgtgaatcaataa

DBGET integrated database retrieval system