KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1640Help
Entry
I33_1640          CDS       T01837                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00010  Glycolysis / Gluconeogenesis
bsr00020  Citrate cycle (TCA cycle)
bsr00620  Pyruvate metabolism
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01120  Microbial metabolism in diverse environments
bsr01130  Biosynthesis of antibiotics
bsr01200  Carbon metabolism
Module
bsr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I33_1640
   00020 Citrate cycle (TCA cycle)
    I33_1640
   00620 Pyruvate metabolism
    I33_1640
Enzymes [BR:bsr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     I33_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 DUF1533 DUF5077 DUF3597
Motif
Other DBs
NCBI-ProteinID: AEP90607
Position
1504934..1506262
Genome map
AA seq 442 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVDEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSDESDDAKTEAQVQSTAEAGQDVAKEEQAQEP
AKATGAGQQDQAEVDPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNG
GAQEAAPQETAAPQETAAKPAAAPAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTL
MDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTDEVIQ
KHYFNIGIAADTEKGLLVPVVKNADRKSVFEISDEINGLATKAREGKLAPAEMKGASCTI
TNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGAT
AQNALNHIKRLLNDPQLILMEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccagatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgtcaagcctaacgacgaggtagacgaagatgatgtactggctgaagtccaa
aatgataaagcagtagtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacggttgcaactgttggacaaacgattattacgtttgatgcacctggt
tacgaagatcttcaatttaaaggcagcgacgagtctgacgatgcgaaaactgaagcacaa
gttcagtcaactgcagaagctggacaagacgttgcgaaagaagagcaagctcaagagcct
gcaaaagctactggcgcaggacagcaggatcaagctgaagttgacccgaacaaacgcgtg
atcgctatgccttccgtacgtaaatatgctcgtgaaaaaggcgtagacatccgtaaggtt
actggttcaggcaacaacgggcgtgttgtaaaagaagatatcgacagctttgtaaacgga
ggagcgcaagaagctgcaccgcaagaaacagctgcaccacaagaaacagctgctaaaccg
gctgctgcaccagctccagagggcgaattcccagaaacacgcgaaaaaatgagcggtatc
cgtaaagcaattgcaaaagcgatggttaactctaaacacactgctcctcacgtaacgtta
atggacgaagtggacgtaacaaatcttgttgcacatcgtaaacagttcaaacaagttgct
gctgatcaaggaatcaagctgacttacttgccttacgttgtaaaagctcttacatctgca
ctgaaaaaattccctgttttaaacacgtcaattgacgataaaacagatgaagtcatccaa
aaacattacttcaacatcggtatcgctgctgacactgaaaaaggcttgcttgtaccggtt
gtgaaaaatgcagatcgtaaatctgtctttgaaatttctgatgagatcaatggccttgca
acaaaagctcgtgaaggcaagcttgctccagctgaaatgaaaggcgcatcttgcacaatt
acaaacatcggttctgccggcggacaatggttcactccggttatcaaccatccagaagtt
gcgattcttggtatcggacgcattgcagaaaaagcgattgttcgtgatggcgaaatcgta
gcagctccagtcttagctctttctctcagcttcgaccaccgtatgatcgacggagcaact
gcgcaaaatgcattaaatcacatcaagcgtttactgaacgatccacaattaattttaatg
gaggcgtaa

DBGET integrated database retrieval system