KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1665Help
Entry
I33_1665          CDS       T01837                                 

Definition
glutaminase 2 (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I33_1665
   00330 Arginine and proline metabolism
    I33_1665
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    I33_1665
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     I33_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1525867..1526796
Genome map
AA seq 309 aa AA seqDB search
MVCRHNDELEALVKKAKKVTDKGEVASYIPALAKADKHDLSVAIYYSNNVCLSAGDVEKT
FTLQSISKVLSLALVLMEYGKDKVFSYVGQEPTGDPFNSIIKLETVNPSKPLNPMINAGA
LVVTSLIRGRTVKERLDYLLSFIRRLTNNQEITYCREVAESEYSTSMINRAMCYYMKQYG
IFEDDVEAVMDLYTKQCAIEMNSLDLAKIGSVFALNGRHPETGEQVISKDVARICKTFMV
TCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYDFGIGIFGPALDEKGNSIAGVKLLEIM
SEMYRLSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtatgccggcataatgatgagcttgaagccttagtgaaaaaggcgaaaaaagtaacg
gacaagggggaggtagccagctatattcccgccttggcaaaagctgataaacacgacctg
tcagtggcgatttattattccaataatgtttgtctgtcagcaggtgacgtagaaaaaaca
tttacgcttcaaagtatatcgaaagtcctttcccttgctttggtgttaatggaatacggc
aaagataaggtcttcagttatgttggacaggagccgaccggtgatccgtttaattcaatt
atcaagctcgaaacagtgaatccgagcaagccgttaaaccctatgattaatgcgggggca
ttggtagtgacaagtttgataagaggaagaacggtgaaagagagacttgattatttgctt
tcttttatcagaaggctgacaaacaaccaagaaattacatactgccgggaagtggctgaa
tctgaatacagcacttcaatgattaatcgggcaatgtgctattatatgaagcagtacggc
atttttgaagatgatgtagaagcagtaatggatttatacacgaagcaatgcgcgattgag
atgaacagcttggatttagccaaaatcggatctgtatttgcattgaacggcagacatcca
gagactggggagcaagtcatctcaaaagatgtcgctagaatttgcaaaacatttatggtg
acgtgcggaatgtacaatgcaagcggggaattcgcaattaaggtcggaattcctgcgaaa
agcggcgtatccggcgggattatgggcatttcgccttacgatttcgggatcggcatattc
ggccccgcattagacgaaaaagggaacagcattgcaggtgtaaagcttttggaaataatg
tctgagatgtacaggctgagtattttttaa

DBGET integrated database retrieval system