KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1736Help
Entry
I33_1736          CDS       T01837                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bsr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bsr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1594951..1595865
Genome map
AA seq 304 aa AA seqDB search
MKHLTTMSELSTEEIKDLLQTAQDLKNGKTDNQLTGKFAANLFFEPSTRTRFSFEVAEKK
LGMNVLNLDGTSTSVQKGETLYDTIRTLESIGVNVCVIRHSEDEYYEELVSQVNIPILNA
GDGCGQHPTQSLLDLMTIYEEFNTFKGLTVSIHGDIKHSRVARSNAEVLTRLGARVLFSG
PSEWQDEENTFGTYVSMDEAVESSDVVMLLRIQNERHQSAVSQEGYLNKYGLTVERAERM
KRHAIIMHPAPVNRGVEIDDSLVESEKSRIFKQMKNGVFIRMAVIQRALQTNVKRGEAAY
VISH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatttaacgacgatgagtgaactcagcactgaggaaatcaaagatttgcttcaa
acagcacaagacctcaaaaacggaaaaacagacaatcagcttacaggaaagtttgcagca
aacctgtttttcgaaccgagcacgagaacgcggttcagctttgaggtcgcagaaaaaaag
ctgggcatgaatgtgctcaaccttgatggaacaagcacaagcgtgcaaaaaggcgaaacc
ttatatgacacgatccggacgctcgaatcaatcggtgtgaacgtctgcgtcatcaggcac
agtgaggatgagtattatgaagagcttgtcagccaggtgaacattccgattctgaatgcg
ggagacggatgcggccagcatccaacacaatcactgcttgatttaatgacgatttatgaa
gagttcaatacgttcaaagggcttaccgtctccattcacggcgacatcaagcatagcaga
gtggcaaggtcaaatgcggaagtgttgacaagattgggtgcccgggtcctattttccggc
ccttcggaatggcaggatgaagaaaatacattcggcacgtatgtctcaatggatgaagca
gttgagtcttccgatgttgtcatgctgctgcgcattcaaaatgaacgacatcagtccgct
gtcagccaggaaggctatttaaacaaatacggcttgaccgtagaacgggctgagcgtatg
aagcggcatgcgatcatcatgcatcctgctccggtaaacagaggagtggagattgatgac
agcttagtagaaagcgaaaaatcaagaatcttcaagcaaatgaaaaatggcgtatttatc
agaatggcagtgatacagcgtgccttacaaaccaatgtgaaaagaggagaagcagcgtat
gtcatatctcattaa

DBGET integrated database retrieval system