KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2036Help
Entry
I33_2036          CDS       T01837                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    I33_2036 (galU)
   00052 Galactose metabolism
    I33_2036 (galU)
   00500 Starch and sucrose metabolism
    I33_2036 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    I33_2036 (galU)
Enzymes [BR:bsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     I33_2036 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1928750..1929643
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGR
NKRSIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSETPALRQLIDVYDVYGTEVVGVQSVLPEDVSKYGMINTSGSQ
GHVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFPVLKTIGRGAGNEIQLTDALREVCR
KQPIHARLLEGNRYDIGDKLGCFKASTEIGLMRSEMRSQLLAYLEDVIKRESKEMLR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggttattcccgcagcaggtttaggaacgagatttctg
ccggcgacaaaggcgcagcctaaagaaatgctcccaatcgtcgacaaaccagcaattcaa
tacattgtagaagaggccgcagagtcaggaattgaagatatactgattattacagggaga
aacaaacgctcgattgaagatcattttgatcggtcggcggaattggaattcaatctgcgg
gaaaaaggcaagacggagacacttaaggaaatgcagcagattgccgatttggccaacatt
cattacatccgccagaaagaaccgctcggattaggccatgcggtgctgtgtgcggagcat
tttatcggagatgagccttttgctgttctcttaggtgatgatattatggtgtctgaaaca
ccggctcttcggcaattaatagatgtgtatgacgtttatggcacagaggttgtcggtgta
cagtcagttctccctgaggatgtcagcaaatatggtatgataaatacatcagggtctcaa
gggcatgtatacgaagtgaacgatttagtggaaaagccttctcctgaagaagcgccttcg
gaaatcgcagtgatgggacgttatgtgctgaattcttcgatcttccccgttttgaagaca
attggcagaggcgcgggcaacgaaattcagctgacagatgcgcttcgtgaggtttgccgt
aagcagccgatccatgcgcggcttttggaaggaaatcgatatgacattggcgataagctg
ggctgttttaaagcaagcaccgaaatcggcttaatgcgttccgaaatgagatctcagctt
ttggcctatttagaagatgtgatcaaacgggaatcgaaagaaatgctgcggtaa

DBGET integrated database retrieval system