KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2069Help
Entry
I33_2069          CDS       T01837                                 

Gene name
proJ
Definition
(GenBank) glutamate 5-kinase 2
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00330  Arginine and proline metabolism
bsr00332  Carbapenem biosynthesis
bsr01100  Metabolic pathways
bsr01130  Biosynthesis of antibiotics
bsr01230  Biosynthesis of amino acids
Module
bsr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    I33_2069 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    I33_2069 (proJ)
Enzymes [BR:bsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     I33_2069 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEP91027
Position
complement(1999056..2000171)
Genome map
AA seq 371 aa AA seqDB search
MTPDTSMKRVVVKIGSSSLTSLHGEISIRKLEALVDQIVKLKDAGYEVILVSSGAVAAGY
RKLGFIQRPEKLPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDEYRYNNV
RNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDG
NPRTNPEAKRIQRVSEITPDIEACAGDTGSIVGTGGMRSKLDAFKIVMASGIKGFLGQAD
AGDILYHAVHEQAEGTYFEAEGTLPLNQKEQWIAFNSGPEGEMILSDDCSRKITNGQSSL
YLDGVQKIKGKFKSGSVVRLMDSKGTEIGLGIVNYSSVQLQEPEKKKELTNRALIDQEAF
VCHVDFSLPVN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcctgatacaagcatgaaaagagtcgttgtgaagattggaagcagttcattaaca
agccttcatggagaaatcagcattcgaaaattagaagcgttggtcgaccagatcgtcaaa
ctcaaagacgccggttatgaagtgattttggtttcctcaggcgcagtggcggcgggatat
cggaagctcggatttatccaaaggcccgagaagcttccagaaaaacaagcatcagcttca
atcggccagggattgctgatggaggcttattcaaagctgtttttggcacacggctatgtc
gcatcccaaattttaattacgagaagcgatttttctgatgaatatcgatacaacaatgtc
aggaatacaatgaatgtactgctcgagcgcggcatcatcccgatcataaacgaaaatgac
acagttaccgtcaatcggctcaagtttggcgacaatgatacgctcgcagcaaaagtcgca
ggattgattgatgcagatatgcttgtgattttatcagatatagacggattatatgacggc
aatccgcgcacaaatccagaagcgaaaaggatacagcgggtgagtgaaataacacctgac
atcgaagcatgcgcaggtgacactggaagcatcgttggcaccggcggcatgcgctctaag
cttgatgcgtttaaaatcgtaatggcgtctggcattaaaggtttcctaggtcaggcagat
gctggcgatattttatatcacgccgttcatgaacaggcggaaggcacctattttgaagca
gaaggaacgcttccgttgaatcaaaaggagcaatggatcgcttttaattccggtccggaa
ggtgaaatgattttatcagatgattgttcacgaaaaataacaaacggccaatcgagttta
tacctggacggtgtacagaagattaaagggaaattcaaaagcggttcagttgttcggctg
atggattcaaaagggacagaaatcggccttggaatcgtcaattactcttctgtacagctt
caagaaccggaaaagaaaaaggaactgacaaacagagctctaattgatcaagaagcattt
gtttgccatgtggatttttctttacctgtaaattaa

DBGET integrated database retrieval system