KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2239Help
Entry
I33_2239          CDS       T01837                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I33_2239
   00670 One carbon pool by folate
    I33_2239
Enzymes [BR:bsr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     I33_2239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2142430..2142936)
Genome map
AA seq 168 aa AA seqDB search
MISFIFAMDANRLIGKDNDLPWHLPNDLAFFKKVTSGHSIIMGRKTFESIGRPLPNRKNI
VVTSAPASEFPGCTVVSSLKDVLDICSGPEECFVIGGAQLYTDLFPYADRLYMTKIHHEF
EGDRHFPEFDESNWKLVSSEQGIKDEKNPYDYEFLIYEKKNSSKAGGF
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatttcattcatttttgcgatggatgccaacaggcttatcggcaaagacaatgatttg
ccgtggcatttgcccaatgatcttgcattctttaagaaagtaacatcgggccattcaatc
attatgggccggaaaacatttgaatcgatcggacgtccgctcccaaatcggaaaaatatt
gtcgttacctcagcgccggcttcagaatttccgggatgcacggttgtcagttcattaaag
gatgtactggacatttgttcaggccctgaagaatgctttgtgatcggaggggctcagctc
tatacggaccttttcccttatgcggacagactgtatatgacgaaaattcatcacgagttt
gagggtgaccgtcacttccctgaatttgatgaatccaattggaagctggtttcttctgag
caggggatcaaagacgaaaaaaacccgtatgattacgaatttttaatatatgaaaaaaag
aattcttctaaagcgggaggattttaa

DBGET integrated database retrieval system