KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2338Help
Entry
I33_2338          CDS       T01837                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bsr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2229893..2230465)
Genome map
AA seq 190 aa AA seqDB search
MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDPKEHFQTIFG
ENHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLSKLARAVEAVAKRPQLQ
ERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVFKDDAAARA
EVLEHIKRQD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttaataaagagcaaatcgaacaagctgttcgtcaaattttagaagcgatc
ggagaagacccgaatagagaagggcttctcgatactccgaaaagagtcgcaaagatgtat
gccgaagtattctccggcttgaatgaagatccaaaagaacatttccagactatcttcggt
gaaaaccatgaggagcttgttcttgtaaaagatatcgcgtttcattctatgtgtgagcat
caccttgttcccttttatggaaaagcacatgttgcatatatcccgcgaggcggaaaggtc
acaggactcagcaaactggcacgtgccgttgaagccgttgcaaagcgcccgcagctacag
gaacgcatcacttctacaattgcagaaagcatcgtagaaacgcttgatccgcatggcgta
atggtagtggttgaagcggaacacatgtgcatgacgatgcgcggtgtaagaaaaccgggt
gcgaaaactgtgacttcagcagtcagaggcgtttttaaagatgatgccgctgcccgtgca
gaagtattggaacatattaaacgccaggactaa

DBGET integrated database retrieval system