KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2567Help
Entry
I33_2567          CDS       T01837                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00010  Glycolysis / Gluconeogenesis
bsr00052  Galactose metabolism
bsr00500  Starch and sucrose metabolism
bsr00520  Amino sugar and nucleotide sugar metabolism
bsr00521  Streptomycin biosynthesis
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01120  Microbial metabolism in diverse environments
bsr01130  Biosynthesis of antibiotics
bsr01200  Carbon metabolism
Module
bsr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I33_2567
   00052 Galactose metabolism
    I33_2567
   00500 Starch and sucrose metabolism
    I33_2567
   00520 Amino sugar and nucleotide sugar metabolism
    I33_2567
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    I33_2567
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    I33_2567
Enzymes [BR:bsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     I33_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FtsA DUF1464
Motif
Other DBs
NCBI-ProteinID: AEP91518
Position
complement(2419273..2420238)
Genome map
AA seq 321 aa AA seqDB search
MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKTGDTITVTIAKTIDSKLDELQKP
KHIIKYIGMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIANGEIVHGINGAGGEIGHICSIPEGGAPCNCGKT
GCIETIASATGIVRIAKEKIANAKKTTRLKATEQLSARDVFEAAGENDEIALEVVDYVAK
HLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAFPRAAQAADISIAALGN
DAGVIGGAWIAKNEWLKHQNC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacgagatatggtttgcgggcattgacctgggaggaacgacgattaaactcgctttt
attaatcaatatggcgaaatccagcataagtgggaagttccgactgataaaaccggcgac
acgattactgtcacaattgcaaaaacaatcgacagcaagctggatgagctgcaaaaaccg
aagcacatcatcaaatacatcggaatgggtgcaccaggccctgtagatatggcggcagga
gttgtttatgaaacagtaaatctagggtggaaaaattatgctttgaaaaaccatctggag
acagaaaccggcatcccagctgttatagaaaatgacgcaaatattgctgcgctcggggaa
atgtggaagggagcgggtgatggcgcaaaagacgtcattctcgtgacgcttggcacagga
gttggcggcggcatcattgcaaatggtgaaattgtacatggcataaatggcgctggcgga
gaaatcggccatatttgcagcatccctgaaggcggagcgccctgtaactgcggcaaaacg
ggctgtatcgaaacaattgcgtcagcaaccggaattgtaagaattgcaaaagaaaaaata
gcaaatgctaaaaagacgacacgtttaaaagcaaccgaacaattgtcagcgcgggatgtg
tttgaagcggcgggtgaaaatgatgaaattgcccttgaggtggttgattatgtagccaag
caccttggtttggtgctcggaaatttggcaagctcgcttaatccgtccaaaatcgttctt
ggcggcggcgtatcgagagccggagaactgctgagatcaaaagtcgagaaaacattccgc
aaatgcgcgtttccgcgggcggcccaagctgctgatatttcaatcgcagcacttggaaat
gatgccggcgttatcggaggcgcttggatcgctaaaaatgaatggctgaaacatcaaaat
tgttaa

DBGET integrated database retrieval system