KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2793Help
Entry
I33_2793          CDS       T01837                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    I33_2793
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     I33_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2606533..2608929)
Genome map
AA seq 798 aa AA seqDB search
MQQHPDQLKLEEEPYLKGTVNTVIYHNDTNLYTVLKVKVTETSEAIEDKAVSVTGYFPAL
QEEETYTFYGKIVTHPKFGLQFQAEHFKKEIPTTKEGIIQYLSSDLFEGIGKKTAEEIVK
KLGDSAINKILADASVLYDVPRLSKKKADTLAGALQRHQGLEQIMISLNQFGFGPQLSMK
IYQAYESETLEKIQENPYQLVKDVEGIGFGKADELGSRMGLSGNHPERVKAAILYTLETT
CLSEGHTYIETEQLIIDTQSLLNQSAREGQRITEMDAANAIIALGENKDIVIEDGRCYFP
SLFYAEQNVAKRVKHIASQTEYENQFPESEFLLALGELEERMNVQYAPSQKEAIQKALSS
PMLLLTGGPGTGKTTVIRGIVELYGELHGVSLDPSAYKKDEAFPIVLAAPTGRAAKRMSE
STGLPAVTIHRLLGWNGAEGFTHTEDQPIEGKLLIIDEASMLDIWLANHLFKAIPDHIQI
IIVGDEDQLPSVGPGQVLRDLLASQVIPTVRLTDIYRQAEGSSIVELAHQMKNGLLPNNL
TAPTKDRSFIRCGGSQIKEVVEKVVANALKKGYTAKDIQVLAPMYRGKAGINELNVMLQD
ILNPPKEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEITSIFYAKENTEKEDMA
VVSFDGNEMTFTKKDFNQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAIT
RAKKFLILCGEEEALEWGVKNNDATVRQTSLKNRLSVQVEEMDAELEALQKELPFSVHDA
NIGMEGITPFDFMKEEQQ
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagcatccggatcagcttaaactggaggaagagccctatttaaaagggacagtc
aacacagtcatctatcataatgacaccaatttatatacggttctgaaagtgaaagtcaca
gagacctccgaagccattgaagataaagccgtatccgtgacgggctacttccctgcgctt
caagaagaagagacctacacgttttacggaaagatcgtaacccatccaaaattcgggctc
caatttcaggcggagcatttcaaaaaggagattccaacgactaaggaaggcatcattcaa
tatttatcgagtgatttattcgaggggatcggcaaaaaaacagctgaagaaattgtgaaa
aagctgggcgacagcgccattaataaaatattggctgatgcttcagtgctttatgatgtt
cccagactctcaaaaaagaaagccgacacgctggctggcgcattgcagcggcatcaggga
ctggagcaaatcatgatttccttgaatcagtttggctttggcccgcagctgtctatgaaa
atctatcaagcctatgaatccgagacgcttgaaaagattcaggaaaatccttatcagctt
gtgaaggatgtagaaggcatcgggtttgggaaagcggatgagctgggcagcagaatgggt
ctttcgggtaaccatcctgagcgggtaaaagctgctattttgtacacgcttgaaacgact
tgtctgtcagaggggcacacgtacatagaaacggaacagctgatcatcgacactcaatca
ctgttaaatcagtcagcaagggaagggcagcgcatcacagaaatggatgccgctaacgca
attattgcccttggagaaaataaagacattgtcatagaagatggccgctgttattttcca
tcgctgttttacgcagaacaaaacgttgcaaagcgtgtgaaacatatcgctagccaaacc
gaatatgagaatcagtttcccgaatcagagtttttgctcgcgttgggagaactggaagaa
cggatgaacgttcagtatgcccccagccagaaggaagcgattcaaaaagccctttcctcg
ccgatgcttcttttaacaggcggcccgggaacaggaaaaacgacggtaatcagagggatt
gtcgagctctacggagagcttcacggtgtgtcactagacccgtcagcttataaaaaggat
gaagcttttccgattgttttggccgctccgacagggagagcagcaaaacggatgagtgaa
tcaacgggacttcctgcagtcacgatacacaggctgcttggctggaacggtgctgaaggc
tttactcatacagaggatcagccgatcgaaggaaagctgttaattatcgatgaagccagc
atgcttgatatatggctggcgaatcatttgttcaaggcgatccctgatcatatacaaatc
atcattgtcggagacgaagaccagctgccttctgtcggtccgggacaagtgctcagagac
ttgctggcatcccaggtgattccgactgtgagactgacagacatctatcgccaggcggag
gggtcatcaatcgtcgagcttgcccaccagatgaaaaatggattgctgccgaacaatttg
actgccccgacaaaggaccgttcctttattcgctgcggcgggtcgcaaatcaaagaagta
gttgagaaggttgtcgccaatgcattgaaaaaaggctatacagcaaaggacattcaggtc
ctcgctccgatgtacagaggaaaagccggcattaatgaattgaatgtgatgctgcaggac
attttaaatcctcctaaagaaaaacggagagaattgaagttcggggatgttgtctacaga
accggagataaaattttgcagcttgtcaatcagccggaaaacaatgtattcaacggagat
attggcgaaatcacgtcgatattttatgcaaaggaaaatacagaaaaagaagacatggcc
gtcgtttcttttgacggcaatgaaatgacatttacgaaaaaagattttaatcaatttacc
catgcgtattgctgttctattcataaatcgcagggaagtgaatttccgattgtggttttg
cctgttgtgaaaggctactatagaatgctcagaagaaaccttctttataccgcgattaca
agagcgaaaaaatttctcattttatgcggtgaggaggaggcgctggagtggggcgtaaaa
aataatgatgcaactgtcagacagacctccttaaaaaacaggctgtccgtacaggttgag
gaaatggatgccgagcttgaggctctccaaaaagagctcccgttcagcgtacacgacgcc
aacattggcatggaaggcattacaccattcgattttatgaaagaagaacagcaataa

DBGET integrated database retrieval system