KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2821Help
Entry
I33_2821          CDS       T01837                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    I33_2821 (ruvA)
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     I33_2821 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2636410..2637015)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQIFTPNPFIYKERSQETIFTYHHIREDAFSLYGF
STREEKALFTKLLNVTGIGPKGALAILGSGDPGAVIQAIEDEDEAFLVKFPGVGKKTARQ
IILDLKGKLADVVPEMIENLFNHEERLEKQTAETALEEALEALRVLGYAEKEIKKVLPHL
KEEIGLTTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaatttgttaaagggacgattgattatgtatctccccaatatattgtcatagag
aacggcggcatcggctatcagattttcacgccgaatccgtttatatataaggagagaagc
caagaaacgatttttacataccatcatatcagagaggatgctttttcgctttacggtttt
tcaacaagagaggagaaggcgctctttacaaagctgttaaacgtgaccggaattggccca
aaaggagcacttgccatcttgggctcgggtgatcccggagcggtcatccaagcaattgaa
gatgaggatgaagcttttttggtcaagtttcctggagtaggaaagaaaaccgcacgccag
attattctagatttaaaaggaaagctggcagatgttgtgcctgaaatgattgaaaatctg
tttaatcatgaagaaaggcttgaaaagcaaacagcggaaacggctcttgaagaagcactt
gaagccctcagggttctcggatatgctgaaaaagaaatcaaaaaggtgcttcctcacctt
aaagaagaaattgggctgacaacagaccaatatgtgaaaaaagcattacaaaaactatta
aagtaa

DBGET integrated database retrieval system