KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2909Help
Entry
I33_2909          CDS       T01837                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.55)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    I33_2909
  Lipid metabolism
   00071 Fatty acid degradation
    I33_2909
Enzymes [BR:bsr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     I33_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2719026..2719802)
Genome map
AA seq 258 aa AA seqDB search
MNAISLAVDQFVAVLTIHNPPANALSSRILEELSSCLDQCETDAGVRSIIIHGEGRFFSA
GADIKEFTSLKGNEDFSLLAERGQQLMERIESFPKPIIAAIHGAALGGGLELAMACHIRI
AADDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALELIGSGEPISGKEALDLGLVSIGA
KDEAEVIEKAKALAAKFAEKSPQTLASLLELLYSNKVYSYEGSLKLEAKRFGEAFESEDA
KEGIQAFLEKRKPQFKGE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaatatcactggcagttgatcaatttgtggcagttttgacgattcacaatccg
ccggcaaatgcgctttccagccggatattagaagagctgtcttcctgtcttgatcaatgt
gagacagatgcaggcgtacgaagcattatcattcacggcgagggaagatttttctcagcc
ggcgctgatattaaagaatttacatcgcttaaaggcaatgaggatttctcattgctcgct
gagcgcggccagcagttaatggagagaatcgaaagctttccaaaaccgattatcgcagcg
attcacggcgctgctctcggaggcgggctggagcttgcgatggcatgtcatatcagaatc
gcggcagatgatgctaagctggggctcccggagcttaatctcggtatcattccgggtttt
gcggggacacagcgccttccgagatatgtcggtacagccaaagcattagagctcatcgga
tcaggagaaccaatatccggaaaagaagcgcttgatctcggacttgtctcaattggagcg
aaagatgaggcagaagtgattgaaaaagcaaaggcacttgccgctaagtttgcagagaaa
agcccgcaaacgctggcatctttgcttgaacttctttattccaacaaggtgtattcctat
gaaggcagcttaaagcttgaagcaaagcgatttggggaagcatttgagtcagaggacgcc
aaggaaggcatccaggcatttctcgaaaaaagaaagcctcagttcaaaggcgaataa

DBGET integrated database retrieval system