KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2938Help
Entry
I33_2938          CDS       T01837                                 

Definition
YsdC
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    I33_2938
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     I33_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2752232..2753317)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKDLTDAKGIPGNEREVRQVMKSYIEPFADEVTTDRLGSLIAKKTGAENG
PKIMIAGHLDEVGFMVTQITDKGFIRFQTVGGWWAQVMLAQRVTIVTKKGEITGVIGSKP
PHILSPEARKKSVEIKDMFIDIGASSREEALEWGVLPGDMIVPHFEFTVMNNEKFLLAKA
WDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGI
AGDTPGISEKEAQSKMGKGPQIIVYDASMVSHKGLRDAVVATAEEAGIPYQFDAIAGGGT
DSGAIHLTANGVPALSITIATRYIHTHAAMLHRDDYENAVKLITEVIKKLDRKTVDEITY
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgaaacattgaccatgctgaaagatttaacagatgcaaaaggcata
ccgggcaatgaaagagaagtaaggcaagtgatgaagtcatacatagaaccatttgctgat
gaggtgacaacagatcgcctgggcagtttaattgccaaaaaaactggtgcagaaaacggc
ccgaaaattatgatcgccggacatttggatgaagtcggctttatggtgacacaaatcaca
gataaaggctttatccgttttcaaaccgttggcggctggtgggctcaggttatgcttgcc
cagcgtgtcaccatcgtcacaaaaaaaggggaaatcacaggggttatcggctctaagccg
cctcatattttgtctcctgaagcaagaaaaaaatcagtggaaataaaagatatgtttatt
gatattggagcttcaagccgggaagaagccttggagtggggtgtactcccgggagatatg
atcgttccgcattttgaatttacggtcatgaacaatgaaaaattcctactcgcaaaggcg
tgggacaaccgcattggctgtgcgattgcaattgatgtgttaagaaacttacaaaacaca
gaccatccaaatatagtgtatggcgtcggaaccgtgcaggaggaagttgggctgagggga
gcgaaaacggctgcacacaccattcagcctgatattgcgtttggtgttgatgtagggata
gcaggagacacgcctggcatttccgagaaggaagcgcagagcaaaatgggcaaaggcccg
cagattatcgtttacgatgcatccatggtctctcacaaaggtttgcgtgatgcagttgta
gccactgcggaggaagccggcattccgtaccaatttgatgccattgccggcggcggaact
gattcgggtgccatccatttgacggcaaatggcgttcctgcgctgtccattaccattgca
acccgctacattcatacgcacgcggccatgctgcatcgtgatgattatgaaaacgcggta
aagttaattacagaagtcattaagaagttagaccgaaaaacggttgacgaaattacgtat
caataa

DBGET integrated database retrieval system