KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2977Help
Entry
I33_2977          CDS       T01837                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00010  Glycolysis / Gluconeogenesis
bsr00030  Pentose phosphate pathway
bsr00051  Fructose and mannose metabolism
bsr00052  Galactose metabolism
bsr00680  Methane metabolism
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01120  Microbial metabolism in diverse environments
bsr01130  Biosynthesis of antibiotics
bsr01200  Carbon metabolism
bsr01230  Biosynthesis of amino acids
bsr03018  RNA degradation
Module
bsr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsr_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I33_2977 (pfkA)
   00030 Pentose phosphate pathway
    I33_2977 (pfkA)
   00051 Fructose and mannose metabolism
    I33_2977 (pfkA)
   00052 Galactose metabolism
    I33_2977 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    I33_2977 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    I33_2977 (pfkA)
Enzymes [BR:bsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     I33_2977 (pfkA)
Protein phosphatases and associated proteins [BR:bsr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     I33_2977 (pfkA)
Messenger RNA biogenesis [BR:bsr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     I33_2977 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEP91920
Structure
PDB: 

Jmol
Position
complement(2788547..2789506)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIANLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatttatcatgacgttgaagtttacggtatttacaacgga
tacgcgggattgatcagcggaaagattgaaaagcttgaactcggatcagtaggcgatatt
atacatcgtggaggaactaagctttatacggcaagatgtcctgaattcaaaacagttgaa
ggtcgtgaaaaagggatagccaacttgaagaagctaggtattgaaggccttgttgttatc
ggcggagacggttcctatatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgttccgggtacaattgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtaatcgaagtaatgggccgtcatgccggcgatatcgcattgtgggcc
ggtcttgcagggggagcggaatcgatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaagcacagtattattattgtt
gccgaaggtgtaggcagcggtgttgaattcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtattgggccatatccagcgcggaggttctccgagtgctgctgac
cgtgtgttagcaagccgtctcggcgcatatgcagttgaactgctgcttgaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatactt
gagacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatctaa

DBGET integrated database retrieval system