KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3054Help
Entry
I33_3054          CDS       T01837                                 

Definition
YtjP
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    I33_3054
  Amino acid metabolism
   00300 Lysine biosynthesis
    I33_3054
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     I33_3054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2858201..2859592)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRKKEDLIRDTQEFLRINSVMDETTAGPGKPFGEGVNASLTSLLELGEKEGFT
TKNLDGFAGHIEWGEGDDIIGVLCHVDVVPPGDGWTSDPFSAEIRNGRIYARGAIDDKGP
TMAAFYALKIVKDMNLPLSKRVRMIIGTDEESDWRCVEHYFKHEEMPTMGFAPDADFPII
NAEKGIIDASLLIPHRPNQAEPKAVLVSFQSGLRLNMVPDAAEAVIEGPKKEEILSSFKD
MLRTTDQKGEAAIENGQLILRMYGLSCHAMEPNNGINAGILLCEFLQQTELDDAGKRFVQ
VVTDKFSGDTRGKKLDIDCEDEISGELTLNVGTLRYKEGQGGELGINIRYPVTAESKVIR
DAFESASEFELGEFKDSKPHHVSADHPLVKTLQKVYEGQLGKKADLISIGGGTYARSLKA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagttgaagtgatcagaaaaaaagaggatttaattcgtgatacgcaggaa
tttttgagaatcaacagtgtcatggacgaaacaaccgccggacccggtaaaccgtttgga
gaaggggtaaacgccagcctgacttcattgctggagcttggagaaaaagaaggctttaca
acaaaaaatcttgacggcttcgcaggtcatattgaatggggggagggcgatgacattatc
ggcgtactttgccatgttgacgtcgtgccgccgggagatgggtggacgagtgatccattt
tcagctgaaatccgcaacggacggatttatgcaaggggcgccattgatgacaaaggcccg
acaatggcggcattctacgcgctgaaaatcgtgaaagacatgaatttgcccctgtccaag
cgagtcagaatgattatcggaacagatgaagaaagcgattggagatgcgtagagcattat
ttcaagcatgaagaaatgccaacaatgggctttgcgcctgacgccgattttccgatcatt
aatgcggaaaaagggatcatcgatgcttctttacttattccgcaccgcccaaatcaagca
gaaccaaaggcagtgcttgtctcgtttcaatcaggccttcgcttaaacatggtgcctgac
gctgcggaagctgtcattgaagggccgaaaaaagaagagattctgtcttcatttaaagac
atgctccgcacgacggaccaaaaaggggaagctgcaatagagaacggacagctcattttg
cgtatgtacggtctttcctgccatgcaatggaaccgaacaatgggatcaatgccggcatt
ttattgtgcgaatttctccagcagactgagcttgacgatgcaggaaagcggtttgtgcaa
gttgtgacagataagttctcaggtgatacaagaggaaagaaactggacatcgactgtgag
gatgaaatcagcggtgagctgacattaaatgtcggaacactgcgctataaagaagggcaa
ggaggcgagctcgggatcaatatccgctatcctgtgacagcggaaagcaaagtgatccgc
gatgcattcgaaagcgcatcagaatttgagctgggagaattcaaagacagcaagccgcat
cacgtgtccgcagatcatccgttagtcaaaaccctgcaaaaggtttatgaaggccagctg
ggtaaaaaagctgacttaatctcaatcggcggggggacttatgcgagatccttaaaagcc
ggtgtcgcgttcggcccgctgttccctggacgccccgacagcgcacaccaaaaggatgaa
tatatcgaaattgatgacctgctgagatcgacagcgttatatgcgcaggccatttacgag
cttgcaaaataa

DBGET integrated database retrieval system