KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3084Help
Entry
I33_3084          CDS       T01837                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bsr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bsr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bsr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2891662..2892960
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDPKRLQESQLMLENLRDRYNPS
VAINSYDDRKLALQNAGYVINAIQVGGYKPSTVIDFEIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEMCPDAWFLNYTNPMATLTGAMLRYTNIKTIGLCHSVQVCTKDLF
KALGMEHDGIEERIAGINHMAWLLEVKKDGTDLYPEIKRRAKEKQKTKHHDMVRFELMDK
FGYYVTESSEHNAEYHPYFIKRNYPELISELQIPLDEYPRRCVKQIENWEKMRDDIVNNK
DLTHERSKEYGSRIIEAMETNEPFTFGGNVLNTGLITNLPSKAVVEVTCVADRKKITPCF
AGELPEQLAALNRTNINTQLMTIEAAVTQKKEAVYQAAMLDPHTSAELSMKDIISMCDDL
FAAHGDWLPEYK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattacatttatcggtgcagggagcacgattttcgccaaaaatgttttggga
gactgcctgttaacagaggcactgaatggatttgagttcgctctttacgacattgatccc
aaacgcctgcaggaatcccagctcatgctcgaaaatctaagagaccgttataacccgagt
gtggccatcaacagctatgatgacagaaaactcgccttgcaaaacgcaggctatgtcatc
aatgcgattcaggttggaggatacaaaccgagcacagtcatcgatttcgagattcctaaa
cggtatgggctgcgccagacgatcgccgatacagtcggcatcggcgggatattcagatct
ctcagaacaatcccggtcttatttgatatcgcaaaagatatggaggaaatgtgccctgac
gcatggttcttaaactatacaaatccaatggccactcttacaggcgccatgctccgctat
accaatatcaaaacaatcgggctctgccacagtgttcaagtgtgcacgaaggatttattt
aaagctctcggaatggagcatgacggaattgaggaacgcatcgcaggcattaatcatatg
gcttggcttttggaagtcaaaaaagacggcacagatttatatccagaaatcaaaaggaga
gcgaaagaaaaacaaaaaacaaagcatcatgatatggtgcggtttgaattaatggataag
ttcggctattatgtcacggaatcgtccgaacataacgcagagtatcacccatactttatt
aaacggaattaccctgaactgatcagcgagctgcaaatcccgctcgacgaatatccgaga
aggtgcgtcaagcaaattgaaaattgggagaaaatgcgggatgatatcgtcaataataaa
gaccttacgcacgaacgctcaaaggaatatggttcaagaattatagaagcgatggaaaca
aacgaaccattcaccttcggaggaaacgtcttgaatacagggctgatcaccaaccttcct
tcaaaagcggttgtggaagtgacatgcgtcgccgacagaaaaaaaattacaccgtgtttc
gccggagaactgcctgagcagcttgcagccttaaaccggacgaatattaatacacagctg
atgacaatcgaagcggctgtcacacaaaaaaaagaagcggtttaccaagctgcaatgctt
gatccgcatacaagcgcggagctttccatgaaggacatcatttccatgtgtgacgattta
tttgcagcacacggcgattggcttccggaatacaaataa

DBGET integrated database retrieval system