KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3324Help
Entry
I33_3324          CDS       T01837                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00260  Glycine, serine and threonine metabolism
bsr00750  Vitamin B6 metabolism
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01120  Microbial metabolism in diverse environments
bsr01230  Biosynthesis of amino acids
Module
bsr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    I33_3324 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    I33_3324 (thrC)
Enzymes [BR:bsr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     I33_3324 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEP92240
Position
complement(3109748..3110806)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIQQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEQLGIELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPNGKIAFGKLAQAVM
YGAEIIAIDGNFDDALKIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGQAPDVL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGAAAIVRNEVIENPETIATAIRI
GNPASWDKAVKAAEESNGKIDEVTDDEILHAYQLIARVEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDISEIKPVTLPTDEDSILEYVKGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggacttatccagcaatataaagaatttttacctgtaacagatcaaacaccg
gcgctaactttacatgaaggaaacacacctcttattcacctgccgaagctgtctgagcag
ctcggaattgagcttcatgtcaaaacggaaggcgtcaatcctacgggatcatttaaagat
cgcggaatggttatggctgtggcaaaggcaaaagaagaaggcaatgacacgattatgtgc
gcgtcaacaggtaacacttccgctgctgcggcagcatatgcagcacgtgctaacatgaaa
tgcattgtcatcatcccgaacggaaaaattgcatttggaaaactcgctcaagctgtgatg
tacggagctgagattatcgcaattgacggaaactttgacgatgcgcttaaaattgtccgt
tccatctgtgagaaatcaccgattgcccttgtcaactcagtcaacccttaccgcattgaa
ggccaaaaaactgctgccttcgaagtgtgtgaacagctggggcaagcgccggatgtttta
gcgatcccggtcggaaacgcgggaaacatcactgcgtactggaagggcttcaaggaatat
catgagaaaaacggcacaggccttccgaaaatgcgcggctttgaagctgagggtgcggcg
gcaatcgtgcgcaatgaagtgattgaaaatccggaaacaatagcgacagccattcgtatc
ggaaacccggcaagctgggacaaagctgtaaaggcagccgaggaatccaatgggaaaatt
gacgaagtcactgatgatgaaatccttcacgcatatcagctgattgcccgtgtagaaggc
gtgtttgcagaaccaggttcttgcgcgtctatcgcaggagtgctgaaacaggtgaaatcc
ggagaaattccgaaaggcagcaaggtcgtagctgtgttaacaggaaatggactgaaagat
ccgaacacagcggtcgacatttcagaaatcaagcccgtcacattgccgactgatgaagac
agcatccttgaatatgtaaaaggagcggcccgtgtatga

DBGET integrated database retrieval system