KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3345Help
Entry
I33_3345          CDS       T01837                                 

Gene name
pucL
Definition
uricase (EC:1.7.3.3)
Orthology
K16838  
urate oxidase / 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:1.7.3.3 4.1.1.97]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    I33_3345 (pucL)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    I33_3345 (pucL)
Enzymes [BR:bsr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     I33_3345 (pucL)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.97  2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
     I33_3345 (pucL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3129136..3130620
Genome map
AA seq 494 aa AA seqDB search
MFTMDALNQMDIQTLTDTLGSIFEHSSWIAKKAAALRPFSSLSDLHHKMAGIVKAADRET
QLDLIKKHPRLGTKKTMSVTSVREQQNAGLSKLEQEEYEEFLKLNEHYYERFGFPFILAV
KGKTKQDIHQALLERLENERETEFQQALEEIYRIARFRLADIITEKGETQMNRTMSYGKG
NVFAYRTFLKPLTGVRQIPESSFTGRDNTVVGIDVTCEIGGDAFLPSFIDGDNTLVVATD
SMKNFIQRHLASYEGTTTEGFLHYVAHRFLDTYSHMDTITLTGEDIPFEAMPAYEEQELG
TSHLVFRRSRNERARSVLKAERTGDTITIKEQYSEIMDLQLVKVSGNSFVGFIQDEYTTL
PEDGNRPLFVYLNISWQYENTDDARATDPARYVAAEQVRDLASTVFHELETPSIQNLIHH
IGCRILTTFPQLTDVSFQSQNHTWDTVVEEIPGSKGKVYTEPRPPFGFQRFTVTREDAEK
EKQKAAEALGSLKA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaatggatgccctgaaccaaatggacatacaaacactgacagacacgcttgga
tctatttttgaacactcgtcatggattgcgaagaaagccgcggcattgcgcccgttttct
tccctttctgaccttcaccacaaaatggccggcattgtaaaagccgcggatcgcgagaca
cagcttgatttaatcaaaaagcaccctcgtctcggaacaaagaaaacaatgagcgttacc
tcggtaagagagcagcaaaacgcggggctcagcaaacttgaacaagaggaatacgaggaa
tttctcaagctgaatgagcactattatgaacgctttggctttccttttattttagcggta
aagggaaagacgaaacaggacattcaccaagccctgctggaaaggcttgagaacgaacga
gaaacggagttccagcaggctcttgaagaaatttaccgcatcgcccgttttcggctggcg
gacatcataactgaaaaaggagagacgcaaatgaacagaaccatgtcttatggcaaagga
aatgtatttgcataccgaacgtttttaaagccgctcacaggagtacggcaaatcccagag
tcttcttttacagggagagacaatactgttgtcggcattgatgtgacatgcgaaattggc
ggagacgcctttctgccatcatttatagacggagataatacactcgtcgtggctacagac
tcaatgaaaaactttattcagcgccatctcgcttcctatgaagggacgacaaccgaggga
ttcttacactatgtggctcaccgatttttagatacctattctcatatggacacgatcact
ttgacaggcgaagacattccgtttgaggcgatgcctgcatacgaggagcaagaactcggc
acaagccacctcgtctttagaagatcacgcaatgaacgcgcccggtctgtgctaaaagcg
gaacgaaccggggatacaataacgatcaaagagcagtacagcgaaatcatggatcttcag
ctcgtcaaggtgagcggcaactccttcgttggctttattcaggacgaatatacgacgctc
ccggaggacggcaaccgcccgctgtttgtctatttaaacatcagctggcagtatgaaaac
acagatgacgcacgtgctaccgatcccgcccgctacgtcgcggctgagcaagttcgtgac
ttggcgagcaccgtttttcacgaactcgaaaccccttcaattcaaaatttaatccatcat
atcggctgcagaatattaacgacattcccgcagctcactgatgtcagcttccaatctcaa
aaccacacatgggatacagtcgttgaagagatcccagggtccaaaggaaaagtctacacc
gaaccgcgcccgccattcggtttccagcgctttaccgtgacaagagaagacgccgagaaa
gaaaaacagaaagccgctgaagcattagggagcctgaaggcctga

DBGET integrated database retrieval system