KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3345Help
Entry
I33_3345          CDS       T01837                                 

Gene name
pucL
Definition
uricase (EC:1.7.3.3)
Orthology
K16838  
urate oxidase / 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:1.7.3.3 4.1.1.-]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bsr00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3129136..3130620
Genome map
AA seq 494 aa AA seqDB search
MFTMDALNQMDIQTLTDTLGSIFEHSSWIAKKAAALRPFSSLSDLHHKMAGIVKAADRET
QLDLIKKHPRLGTKKTMSVTSVREQQNAGLSKLEQEEYEEFLKLNEHYYERFGFPFILAV
KGKTKQDIHQALLERLENERETEFQQALEEIYRIARFRLADIITEKGETQMNRTMSYGKG
NVFAYRTFLKPLTGVRQIPESSFTGRDNTVVGIDVTCEIGGDAFLPSFIDGDNTLVVATD
SMKNFIQRHLASYEGTTTEGFLHYVAHRFLDTYSHMDTITLTGEDIPFEAMPAYEEQELG
TSHLVFRRSRNERARSVLKAERTGDTITIKEQYSEIMDLQLVKVSGNSFVGFIQDEYTTL
PEDGNRPLFVYLNISWQYENTDDARATDPARYVAAEQVRDLASTVFHELETPSIQNLIHH
IGCRILTTFPQLTDVSFQSQNHTWDTVVEEIPGSKGKVYTEPRPPFGFQRFTVTREDAEK
EKQKAAEALGSLKA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaatggatgccctgaaccaaatggacatacaaacactgacagacacgcttgga
tctatttttgaacactcgtcatggattgcgaagaaagccgcggcattgcgcccgttttct
tccctttctgaccttcaccacaaaatggccggcattgtaaaagccgcggatcgcgagaca
cagcttgatttaatcaaaaagcaccctcgtctcggaacaaagaaaacaatgagcgttacc
tcggtaagagagcagcaaaacgcggggctcagcaaacttgaacaagaggaatacgaggaa
tttctcaagctgaatgagcactattatgaacgctttggctttccttttattttagcggta
aagggaaagacgaaacaggacattcaccaagccctgctggaaaggcttgagaacgaacga
gaaacggagttccagcaggctcttgaagaaatttaccgcatcgcccgttttcggctggcg
gacatcataactgaaaaaggagagacgcaaatgaacagaaccatgtcttatggcaaagga
aatgtatttgcataccgaacgtttttaaagccgctcacaggagtacggcaaatcccagag
tcttcttttacagggagagacaatactgttgtcggcattgatgtgacatgcgaaattggc
ggagacgcctttctgccatcatttatagacggagataatacactcgtcgtggctacagac
tcaatgaaaaactttattcagcgccatctcgcttcctatgaagggacgacaaccgaggga
ttcttacactatgtggctcaccgatttttagatacctattctcatatggacacgatcact
ttgacaggcgaagacattccgtttgaggcgatgcctgcatacgaggagcaagaactcggc
acaagccacctcgtctttagaagatcacgcaatgaacgcgcccggtctgtgctaaaagcg
gaacgaaccggggatacaataacgatcaaagagcagtacagcgaaatcatggatcttcag
ctcgtcaaggtgagcggcaactccttcgttggctttattcaggacgaatatacgacgctc
ccggaggacggcaaccgcccgctgtttgtctatttaaacatcagctggcagtatgaaaac
acagatgacgcacgtgctaccgatcccgcccgctacgtcgcggctgagcaagttcgtgac
ttggcgagcaccgtttttcacgaactcgaaaccccttcaattcaaaatttaatccatcat
atcggctgcagaatattaacgacattcccgcagctcactgatgtcagcttccaatctcaa
aaccacacatgggatacagtcgttgaagagatcccagggtccaaaggaaaagtctacacc
gaaccgcgcccgccattcggtttccagcgctttaccgtgacaagagaagacgccgagaaa
gaaaaacagaaagccgctgaagcattagggagcctgaaggcctga

DBGET integrated database retrieval system