KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3509Help
Entry
I33_3509          CDS       T01837                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    I33_3509 (tpiA)
   01230 Biosynthesis of amino acids
    I33_3509 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I33_3509 (tpiA)
   00051 Fructose and mannose metabolism
    I33_3509 (tpiA)
   00562 Inositol phosphate metabolism
    I33_3509 (tpiA)
Enzymes [BR:bsr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     I33_3509 (tpiA)
Exosome [BR:bsr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   I33_3509 (tpiA)
  Exosomal proteins of bladder cancer cells
   I33_3509 (tpiA)
  Exosomal proteins of melanoma cells
   I33_3509 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3276745..3277506)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEESGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKTVAESFSQEAADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatcgccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agcttcgttgaagaagtgaaatcttccattccagcagcagacaaagctgaagctgttgtt
tgcgcgccagcgcttttcttagaaaagcttacttctgctgtgaaaggcactgacctaaaa
gtcggcgctcaaaacatgcacttcgaagaaagcggcgcgttcacaggcgaaatcagcccg
gttgctctgaaagaccttggcgttgactactgtgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcacacgcagctttcaaacacggc
attgtgccgatcatctgtgtaggtgaaacgcttgaagagcgtgaagccggcaaaacaaat
gatcttgttgctgaccaagtgaaaaaaggccttgctggtctttctgaagaacaagttgct
gcttctgttattgcgtatgagccaatctgggcaatcggaacaggcaaatcttctacagcg
aaagatgcgaatgacgtgtgtgcgcatatccgtaaaaccgtcgctgaaagcttcagccaa
gaagctgcagacaagcttcgcatccaatatggcggaagcgtaaagcctgcaaacattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcgagccttgagcca
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system