KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3532Help
Entry
I33_3532          CDS       T01837                                 

Definition
beta-galactosidase family (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    I33_3532
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     I33_3532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3300368..3302428)
Genome map
AA seq 686 aa AA seqDB search
MSKLEKTHVTKAKFMLHGGDYNPDQWLDRPDILADDIKLMKLSHTNTFSVGIFAWSALEP
EEGVYQFEWLDDIFERIHSIGGRVILATPSGARPAWLSQTYPEVLRVNASRVKQLHGGRH
NHCLTSKVYREKTRHINRLLAERYGHHTALLMWHISNEYGGDCHCDLCQQAFREWLKSKY
DNSLKALNHAWWTPFWSHTFNDWSQIESPSPIGENGLHGLNLDWRRFVTDQTISFYKNEI
IPLKELTPDIPITTNFMADTPDLIPYQGLDYSKFAKHVDVISWDAYPVWHNDWESTADLA
MKVGFINDLYRSLKQQPFLLMECTPSAVNWHNVNKAKRPGMNLLSSMQMIAHGSDSVLYF
QYRKSRGSSEKLHGAVVDHDNSPKNRVFQEVAKVGETLERLSEVVGTKRPAQTAVLYDWE
NHWALEDAQGFAKATKCYPQTLQQHYRTFWEHDIPVDIITKEQDFSPYKLLIVPMLYLIS
EDTISRLKAFTADGGTLVMTYISGIVNEHDLTYTGGWHPDLQAIFGVEPLETDTLYPKDR
NAVSYRGKTYEMKDYATVIDVKTASVEAVYQEDFYARTPAVTSHEYQQGKAYFIGARLED
QFQRDFYEDLITDLSLSPVFPVRHGKGVSVQARQDQDNDYIFVMNFTEEKQLVTFDQSVK
DIMTGDILSGDLTIEKYEVRIVVNTH
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagcttgaaaaaacgcacgtaacaaaagcaaaatttatgctccatgggggagac
tacaaccccgatcagtggctggatcggcccgatattttagctgacgatatcaaactgatg
aagctttctcatacgaatacgttttctgtcggcatttttgcatggagtgcacttgagccg
gaggagggcgtatatcaatttgaatggctggatgatatttttgagcggattcacagtata
ggcggccgggtcatattagcaacgccgagcggagcccgtccggcctggctgtcgcaaacc
tatccggaagttttgcgcgtcaatgcctcccgcgtcaaacagctgcacggcggaaggcac
aaccactgcctcacatctaaagtctaccgagaaaaaacacggcacatcaaccgcttatta
gcagaacgatacggacatcacacggcgctgttaatgtggcacatttcaaacgaatacggg
ggagattgccactgtgatctatgccagcaggctttccgggagtggctgaaatcgaaatat
gacaacagcctcaaggcattgaaccatgcgtggtggactcctttttggagccatacgttc
aatgactggtcacaaattgaaagcccttcgccgatcggtgaaaatggcttgcatggcctg
aatttagattggcgccggttcgtcaccgatcaaacgatttcgttttataaaaatgaaatc
attccgctgaaagaactgacgcctgatatccctatcacaacgaattttatggctgacaca
ccggatttgatcccgtatcagggcctcgactacagcaaatttgcaaagcatgtcgatgtc
atcagctgggacgcttatcctgtctggcacaatgactgggaaagcacagctgatttggcg
atgaaggtcggctttatcaatgatctgtaccgaagcttgaagcagcagcctttcttatta
atggagtgtacgccaagcgcggtcaattggcataacgtcaacaaggcaaagcgcccgggc
atgaatctgctgtcgtctatgcaaatgattgcccacggctcggacagcgttctctatttc
caatatcggaaatcacgggggtcatcagaaaaattacacggagcggttgtggatcatgac
aatagcccgaagaaccgcgtctttcaagaagtggccaaggtaggcgagacattggaacgg
ctgtcggaagttgtcggaacgaagaggccggctcaaaccgcggttttatatgactgggaa
aatcattgggcgctcgaggatgctcaggggtttgcgaaggcgacaaaatgttatccgcaa
acgcttcagcagcattaccgcacattctgggaacacgatatccctgtcgacattatcacg
aaagaacaagatttttcaccatataaactgctgatcgtcccgatgctgtatttaatcagc
gaggacaccatttcccgattgaaagcgtttacggctgacggcggcaccctagtcatgacg
tatatcagcgggattgtgaatgagcatgacttaacatacacaggcggatggcatccggat
cttcaagctatatttggagttgagcctcttgaaactgacactctgtatccgaaggatcga
aacgctgtcagctaccgcggcaaaacatacgaaatgaaggattatgcaaccgtgattgat
gtaaagactgcttcagtggaagccgtgtatcaagaagatttttatgcgcgtacgccagcg
gtcacaagccatgagtatcagcagggcaaggcgtattttatcggtgcgcgtttggaggat
caatttcagcgtgatttctatgaggatctgatcacagacctgtctctttcacctgttttt
ccggttcggcacggaaaaggcgtctccgtacaagcgaggcaggatcaggacaatgattat
atttttgtcatgaattttacggaagaaaaacagctggtcacgtttgatcagagtgtgaag
gacataatgacaggagacatattgtcaggcgacctgacgattgaaaagtatgaagtgaga
attgtcgtaaacacacattag

DBGET integrated database retrieval system