KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3721Help
Entry
I33_3721          CDS       T01837                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    I33_3721 (rbsK)
Enzymes [BR:bsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     I33_3721 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3494313..3495194
Genome map
AA seq 293 aa AA seqDB search
MRNICVIGSCSMDLVVTSDKRPKAGETVLGTSFQTVPGGKGANQAVAAARLGAQVFMVGK
VGDDHYGTAILNNLKANGVRIDYMEPVTHTESGTAHIVLAEGDNSIVVVKGANDDITPAY
ALNALEQIEKVDMVLIQQEIPEETVDEVCKYCHSHDIPIMLNPAPARPLKQETIDHATYL
TPNEHEASILFPELTISEALALYPAKLFITEGKQGVRYSAGSKEVLIPSFPVEPVDTTGA
GDTFNAAFAVALAEGKDIEAALRFANRAASLSVCSFGAQGGMPTRNEVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatatttgtgtgattggtagctgttctatggatttagtggtcacctcggacaaa
cgcccaaaagccggtgaaacggttcttggcacgtcatttcaaactgtgccgggcggcaaa
ggcgcaaatcaggccgttgccgccgccagacttggggctcaagtgtttatggtcggcaag
gttggagacgatcattatggaacagctattttgaataatctcaaagcaaacggcgttcgc
attgactatatggaaccggttacacatacggaaagcggaaccgctcatattgtgcttgct
gaaggcgacaacagcattgtcgttgtcaaaggcgcgaacgatgacatcaccccagcgtat
gcgttaaacgcgctcgaacagattgaaaaggtcgatatggtgctgattcagcaggaaatc
ccagaagaaacggttgatgaggtgtgcaaatactgccattctcacgatatcccgatcatg
ctaaacccagcacccgcccgcccgctcaagcaagaaacaattgatcacgccacttatctg
acgccgaatgaacacgaggcttcgattttattccctgagcttaccatttctgaagctctg
gcgctttatccggcaaagctctttattacggaaggaaaacaaggcgtccgctattcggct
ggcagcaaagaggtgctcatcccgtccttccctgttgagcccgttgatacaaccggagcc
ggtgatacgtttaacgcagcatttgccgtggccctggctgagggaaaagacattgaagcc
gcattgcggtttgccaatcgtgccgcttccctttctgtctgttccttcggtgcccaaggc
ggaatgccgacaagaaatgaagtagaggagctgctgtcatga

DBGET integrated database retrieval system