KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3819Help
Entry
I33_3819          CDS       T01837                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bsr00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bsr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3581114..3582424)
Genome map
AA seq 436 aa AA seqDB search
MEKIIVRGGQKLNGTVKVEGAKNAVLPVIAASLLASEEKSVICDVPTLSDVYTINEVLRH
LGADVHFENNEVTVNASYALQTEAPFEYVRKMRASVLVMGPLLARTGHARVALPGGCAIG
SRPIDQHLKGFEAMGAEIKVGNGFIEAEVKGRLQGAKIYLDFPSVGATENLIMAAALAEG
TTTLENVAKEPEIVDLANYINGMGGKIRGAGTGTIKIEGVEKLHGVKHHIIPDRIEAGTF
MVAAAITEGNVLVKGAVPEHLTSLIAKMEEMGVTIKDEGEGLRVIGPKELKPIDIKTMPH
PGFPTDMQSQMMALLLRASGTSMITETVFENRFMHAEEFRRMNGDIKIEGRSVIINGPVQ
LQGAEVAATDLRAGAALILAGLVAEGHTRVTELKHLDRGYVDFHKKLAALGADIERVNDE
SASEQENKEVVSDLNA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaatcatcgtccgcggcggtcagaagttaaacggcacagtcaaagttgaaggc
gctaaaaatgccgttttacctgttatcgctgcatctttattagcaagtgaagaaaaaagc
gtaatttgtgatgtacctacgctctccgatgtatatacaattaacgaagtgttgcgtcat
ttaggagcagatgtgcattttgagaataatgaagtgactgtaaatgcttcatacgctttg
caaactgaagcaccttttgaatatgttcgtaaaatgcgtgcgtctgtgcttgtcatgggg
ccgcttcttgcgcgtacaggtcatgcaagagttgcacttccgggcggatgcgcaattggt
tccagaccgattgatcagcatttaaaaggttttgaagcaatgggcgcagaaatcaaagtc
ggcaatggcttcattgaagctgaagtaaaaggccgactgcaaggagcaaaaatttatctg
gacttcccaagtgtaggagctacagagaacctgattatggcagccgctctagctgaagga
acaacaacgctggaaaacgtggcaaaagaacccgaaatcgttgatttagcaaactatatc
aacggcatgggcggaaaaatccgcggagctggcaccggcaccatcaaaattgaaggagtc
gaaaagcttcacggcgtaaaacaccatattattcctgaccgcattgaagcgggcacattt
atggttgctgctgcaatcactgaaggaaacgtattagtaaaaggagcggttcctgaacac
ctcacctctttaattgcaaaaatggaagagatgggtgtaacaattaaggatgaaggtgaa
ggcctgcgtgtcatcggcccgaaagaacttaaaccgattgacatcaaaacaatgcctcac
ccgggcttcccgactgatatgcagtcacaaatgatggcgcttctgcttcgtgcaagcggc
acaagcatgattacagaaaccgtttttgaaaaccgttttatgcatgcggaagaattccgc
cgtatgaatggtgatatcaagattgaaggacgttctgtcatcattaacggtcctgtacag
cttcagggagctgaagttgcagcgactgatttgcgtgcaggtgcagcgctgattcttgcg
gggttagtggctgaaggtcacacacgtgttactgaattgaagcacttagaccgcggttac
gttgatttccataagaagcttgccgctctgggcgcagacatcgaacgtgtaaatgatgag
tctgcttctgagcaagagaataaagaagtcgtttctgacttaaatgcataa

DBGET integrated database retrieval system