KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_4194Help
Entry
I33_4194          CDS       T01837                                 

Definition
formaldehyde dehydrogenase, glutathione-independent (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    I33_4194
  Energy metabolism
   00680 Methane metabolism
    I33_4194
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    I33_4194
Enzymes [BR:bsr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     I33_4194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3940447..3941658)
Genome map
AA seq 403 aa AA seqDB search
MTGNKAVVYKGKGTVTVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKTQKTHV
CLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLTMLSDI
FPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFG
CETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMDVTQVG
GSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLMKAILS
GRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgacaggaaacaaagcggttgtgtacaaaggcaaagggactgtaacggtggaggatatc
ggttatccggagttaatcttgagggacgggcccggtgttccgaaggcgaatgtgaatcga
aaatgtgagcatggggttattctcaaagtcattacaaccaacatttgcgggagcgaccag
catatggtcagaggccgcacaacggcgcctgaaggcttggtgctcggacatgaaatcacc
ggagaagtcattgaaacggggcgggatgtcgaatttatcaaaaaaggcgatatcgtatcc
gttcctttcaatattgcctgcggacgctgtgtgatgtgcaaaacgcagaaaacgcatgtg
tgcctgaatgtcaatccggatcggccgggatcggcttacggctacgtcgatatgggcggc
tgggtcggcggccagtctgaatatgtcatggtgccatacgctgattttcagcttttggta
ttccctgataaagaacaggcgttagaaaagattctcgatttgaccatgctgtcggacata
ttcccgaccggcttccacggagcttacacagcgggcgtgcaaacaggttcaaccgtttat
atcgcgggagcggggcctgtcggcttagcagccgctcactccgctcagctcctaggcgcc
tccaccgtgattgtcggagatctgaacgaagacagactggcacaggcgagaagcttcggc
tgtgaaacggtcaacgtacaaaaacacgaccgcctcggcgagcaaattgaacaaatacta
ggtgaaccaaccgttgatgccgcagtggactgtgtcggctttgaagcatccggacacggc
aatcaaggagaagcgcctgccgccgtgctgaactcgatcatggacgtcacccaggtcgga
ggcagccttggcattccaggcttatatgtgaccgaagatcccggcgcaaaggatgcggac
gccaaaacaggctcattaaaaatccgcttcggactcggctgggccaaagcccacaccttc
gtcaccggacaaacgcccgccatgacatacaaccgcaatttgatgaaagcgatcctgagc
ggcagagcgcagatcgcaaaagcagtcaacgccaccgtcatttctctggacgacgcgcca
aaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtcatcgacccgcatgga
acactgaagtaa

DBGET integrated database retrieval system