KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_00040Help
Entry
BSUW23_00040      CDS       T01302                                 

Gene name
gyrA
Definition
DNA gyrase subunit A
Orthology
K02469  
DNA gyrase subunit A [EC:5.99.1.3]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7005..9470
Genome map
AA seq 821 aa AA seqDB search
MNEQNTPQVREINISQEMRTSFLDYAMSVIVSRALPDVRDGLKPVHRRILYAMNDLGMTS
DKAYKKSARIVGEVIGKYHPHGDSAVYESMVRMAQDFNYRYMLVDGHGNFGSVDGDSAAA
MRYTEARMSKISMEILRDITKDTIDYQDNYDGSEREPVVMPSRFPNLLVNGAAGIAVGMA
TNIPPHQLGEIIDGVLAVSENPDITIPELMEFIPGPDFPTAGQILGRSGIRKAYESGRGS
ITIRAKAEIEQTSSGKERIIVTELPYQVNKAKLIEKIADLVRDKKIEGITDLRDESDRTG
MRIVIEIRRDANANVILNNLYKQTALQTSFGINLLALVDGQPKVLNLKQCLEHYLDHQKV
VIRRRTAYELRKAEARAHILEGLRIALDHLDAVISLIRNSQTAEIARTGLIEQFSLTEKQ
AQAILDMRLQRLTGLEREKIEEEYLSLVKLIAELKDILANEYKVLEIIREELTEIKERFN
DERRTEIVTAGLETIEDEDLIERENIVVTLTHNGYIKRLPASTYRSQKRGGKGVQGMGTN
EDDFVEHLISTSTHDTILFFSNKGKVYRAKGYEIPEYGRTAKGIPIINLLEVEKGEWINA
IIPVTEFNAELYLFFTTKHGVSKRTSLSQFANIRNNGLIALSLREDDELMGVRLTDGTKQ
MIIGTKNGLLIRFPETDVREMGRTAAGVKGITLTDDDVVVGMEILEEESHVLIVTEKGYG
KRTPAEEYRTQSRGGKGLKTAKITENNGQLVTVKATKGEEDLMIITASGVLIRMDINDIS
ITGRVTQGVRLIRMAEEEHVATVALVEKDEEDENEETQEEV
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaaaacacaccacaagttcgtgaaataaatatcagtcaggaaatgcgtacg
tccttcttggattatgcaatgagcgttattgtgtcccgtgctcttccagatgttcgtgat
ggtttaaagccggttcatagacggattttgtatgctatgaatgatttggggatgacgagt
gacaaggcttataaaaaatccgcgcgtatcgttggagaagttatcgggaaataccaccca
cacggtgattcagcggtatatgaatccatggtcagaatggcgcaggatttcaactatcgt
tatatgctcgttgacggtcacggaaacttcggttctgttgacggagactcagcggctgcc
atgcgttatacagaagcaagaatgtctaagatctcgatggaaattcttcgagatatcaca
aaagacacaattgattatcaggataactatgatgggtcagaaagagaacctgttgttatg
ccttcaaggttcccgaatctgctcgtgaacggtgctgccggtattgcggtaggtatggca
acaaacattcctccgcaccagcttggggaaatcattgacggtgtacttgctgtcagtgag
aacccggacattacaatcccggagcttatggaattcattccagggcctgatttcccgact
gcgggtcaaatcttgggacgaagcggtatacggaaggcatacgaatctggccgaggctca
attacgattcgagcaaaagctgagatcgaacaaacgtcttcaggtaaagaaagaattatc
gttacagagttaccttaccaagtaaataaggcgaaattaatcgagaaaattgctgatctc
gttagagacaaaaagatagagggcatcacagatctgcgtgatgagtcagatcgtacaggt
atgagaattgtcattgaaatcagacgcgatgccaatgcaaatgttattctaaacaaccta
tacaaacaaactgcgctacaaacgtcttttggtatcaacctgcttgcgcttgttgacggt
cagccgaaagttttaaatctaaagcagtgcctagagcattaccttgaccatcaaaaagtc
gtaatcagacgccgtacggcatatgaattgcgtaaagcggaagcgagagctcatatcttg
gaaggtttgagaattgctctcgatcatctcgatgcagttatttctcttatccgtaattct
caaacggctgaaatagctagaacaggtctaattgaacaattctcactgacagagaagcaa
gcacaagcgatcctcgatatgaggctgcagcgtttaacaggactagaacgtgaaaagatc
gaagaagaatatctatctcttgttaaattaattgcagagctaaaagacattttggcaaat
gaatataaagtgcttgagatcatccgtgaagaactcactgaaatcaaagagcgtttcaac
gatgaaagacgcacggagatcgtcactgctggactagaaacaattgaagatgaagatctt
atcgagagagaaaatatcgtcgttactctgacacacaacggatacatcaaacgtcttcct
gcatcaacttaccgcagtcaaaaacgaggcggaaaaggtgtacagggaatgggaacaaac
gaagatgatttcgttgaacatttgatttctacgtcaactcatgacacgattctcttcttc
tcgaacaaaggaaaagtgtatcgtgcaaaagggtatgaaatccctgaatacggcagaaca
gcaaaaggaatcccgattattaacctgctggaggtagaaaagggtgaatggattaacgca
attattccagtcactgaattcaatgcggagctttaccttttcttcacaacaaagcacggg
gtttcaaaacgaacttcgctgtctcagttcgctaatatccgcaacaatggcctaatcgct
cttagtcttcgtgaggatgatgaattgatgggtgtacgtctgactgacggtacaaaacaa
atgatcatcggaacgaaaaatggattgctgatccgtttccctgaaacagatgtccgggaa
atgggaagaactgcggcaggcgtaaaaggcatcaccctgaccgatgacgacgttgtcgtc
ggcatggagatattagaggaagaatcacatgtccttatcgtaactgaaaaaggttacgga
aaacgaactccggctgaagagtacagaacccaaagccggggcggaaaaggactcaaaaca
gcgaaaatcaccgagaacaacggccaattagtaacagtaaaagctactaaaggtgaagag
gatctaatgattattacggccagcggtgtactcattagaatggacatcaatgatatctca
atcaccggacgtgtcactcaaggtgtacgcctcatcagaatggcggaagaagagcatgtt
gctacagtagcattagtagagaaagacgaagaagatgagaatgaagaaacacaagaagaa
gtgtga

DBGET integrated database retrieval system