KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_00075Help
Entry
BSUW23_00075      CDS       T01302                                 

Gene name
dck
Definition
(GenBank) deoxyadenosine/deoxycytidine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00230  Purine metabolism
bss00240  Pyrimidine metabolism
bss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BSUW23_00075 (dck)
   00240 Pyrimidine metabolism
    BSUW23_00075 (dck)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BSUW23_00075 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     BSUW23_00075 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 SKI AAA_33 TsaE Cytidylate_kin2 ABC_tran AAA_15 AAA_17 RsgA_GTPase AAA_22 Cytidylate_kin AAA AAA_16 RNA_helicase MMR_HSR1 AAA_25 AAA_29 PRK GTP_EFTU AAA_14 ParA AAA_5
Motif
Other DBs
NCBI-ProteinID: ADM36073
UniProt: E0TXM3
Position
complement(22514..23167)
Genome map
AA seq 217 aa AA seqDB search
MKEHHIPKNSIITVAGTVGVGKSTLTKALAKRLGFKTSLEEVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADKGTMSKIDYKTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENILNRIEERGREMELQTSRSYWEEMHTRYENWISGFNA
CPVLKLRIEDYDLLNDESSIENIVDQIASVIHENQKK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacatcatatccccaagaattcaattatcacagtagcaggaacagtaggtgtc
ggaaagtcgactttaacaaaagctttggctaaaaggcttggatttaaaacctctcttgag
gaagtcgatcataatccatacttagaaaagttctatcatgattttgaacgttggagcttt
cacctgcaaatctatttcttagctgaacgattcaaagaacagaaaacgatttttgaagct
ggcggaggatttgtacaggatcgttctatttatgaagacacaggaattttcgcaaaaatg
catgctgacaaagggacaatgtcaaagattgattataaaacttacacaagccttttcgaa
gcaatggtcatgacaccgtatttcccacacccagatgtattgatctatttagaaggagat
ctggagaacattttaaatcggattgaagaacgcggccgtgaaatggagcttcagacaagc
cggtcttattgggaagaaatgcatacacgctatgaaaactggataagcggttttaacgcc
tgccctgttttaaagctccgtattgaggattatgatctgctgaacgatgaaagctcgatt
gaaaatattgtagatcaaatcgcttcagttattcatgaaaatcaaaaaaagtga

DBGET integrated database retrieval system