KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_00235Help
Entry
BSUW23_00235      CDS       T01302                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSUW23_00235 (ispE)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BSUW23_00235 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53611..54480
Genome map
AA seq 289 aa AA seqDB search
MRILEKAPAKINLSLDVTRKRPDGYHEVEMIMTTIDLADRIELTELAEDEVRVSSHNRFV
PDDQRNLAYQAAKLIKDRYNVKKGVSIMITKVIPVAAGLAGGSSDAAATLRGLNRLWNLN
LSAETLAELGAEIGSDVSFCVYGGTALATGRGEKIKHISTPPHCWVILAKPTIGVSTAEV
YRQLKVDDVEHPDVHGMIEAIEEKSFQKMCSRLGNVLESVTLDMHPEVAMIKNQMKRFGA
DAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRMIGEQNALD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttagaaaaagcgccagccaagatcaatctgtcacttgacgtcacccgaaag
cgcccggatggctatcatgaagtcgaaatgatcatgacgacgattgatttagcggatcgg
attgaattgacggagctggcagaggatgaagtgagggtttcctcccacaaccgttttgtg
cccgatgaccaaaggaacttagcttatcaggctgccaagctgatcaaggacagatacaac
gtgaaaaagggagtttccatcatgattacgaaggtgattccggtggctgccggtcttgcc
ggcggaagcagtgatgcggcggcgacccttagagggctgaacagactgtggaatttaaat
ctgtccgcagaaacgcttgctgagcttggagcggagattggctccgacgtttcattttgt
gtctatggcggaactgcactagcaacaggacgcggcgagaaaattaaacacatcagcacg
cctccgcactgctgggtcattttagcgaagccgacaatcggtgtttcaactgctgaagtg
tacagacagctaaaggtggatgatgtagagcatcccgatgtacacggcatgattgaggct
atagaggaaaagagttttcaaaagatgtgcagccgtttaggaaatgtgcttgaatctgtt
acgcttgatatgcatcctgaagtcgcgatgatcaaaaaccagatgaaacgctttggcgca
gatgccgttttaatgagcgggagcggcccgacagtgtttggactggttcagtatgagtcg
aaggtgcagagaatttataacgggttaagaggcttctgcgatcaggtttatgcggtgaga
atgatcggcgaacagaacgctcttgattaa

DBGET integrated database retrieval system