KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_00395Help
Entry
BSUW23_00395      CDS       T01302                                 

Gene name
sul
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSUW23_00395 (sul)
Enzymes [BR:bss01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BSUW23_00395 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85833..86690
Genome map
AA seq 285 aa AA seqDB search
MAQQTIDQTQVIHTKPSALSYKEKTLVMGILNVTPDSFSDGGKYDSLDKALLHAKEMIDD
GAHIIDIGGESTRPGAEYVSEDEEMSRVIPVIERITKELGVPISVDTYKASVADEAVKAG
ASIINDIWGAKHDPKMASVAAEHNVPIVLMHNRPERNYNDLLPDMLSDLMESVKIAVEAG
VEERNIILDPGIGFAKTYHDNLAVMNKLEILSGLGYPVLLATSRKRFIGRVLDLPPEERA
EGTGATVCLGIQKGCDIVRVHDVKQIARMAKMMDAMLNKGGVHHG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaaacgatagaccaaacacaggtaatccacaccaagcccagcgctttatca
tataaagagaagacactggtgatggggattttaaatgtaacgcctgactctttctcggac
ggcggaaaatacgacagcttggacaaggccctcctgcacgcgaaagagatgatcgatgac
ggtgcccatatcattgatatcggaggagaatcgacaaggcctggcgctgaatatgtctca
gaggatgaggaaatgtccagagtgattccggtaattgagcggatcacaaaagaactgggc
gtgccgatttctgtagatacgtacaaggcttctgtcgcagatgaagctgttaaagccggc
gcatccatcatcaatgatatttggggagcgaaacatgatccgaagatggcttctgttgca
gccgaacacaatgttccgattgttctcatgcataaccgccctgagagaaattacaatgac
ttattgccggatatgctgtcggacttaatggagagtgtaaaaatcgctgttgaggccgga
gtagaggagaggaacattatccttgatccaggtattggttttgcgaaaacctatcatgat
aatttggcagtgatgaataaactcgagattttgagcgggctggggtatccggttcttctg
gcaacctcccgaaaaagattcatcgggcgtgttctggatcttccacctgaggagcgggct
gagggcacaggggcgaccgtgtgtctcggcattcaaaaaggctgtgacattgtcagggtc
catgacgtgaaacaaattgccagaatggcgaaaatgatggacgcgatgctgaataaggga
ggggtgcaccatggataa

DBGET integrated database retrieval system