KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_00860Help
Entry
BSUW23_00860      CDS       T01302                                 

Gene name
ybbD
Definition
beta-hexosaminidase, lipoprotein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bss00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bss00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(175955..177883)
Genome map
AA seq 642 aa AA seqDB search
MKPVFPLILSAVLFFSCFLGASQTKATSSSGSADAKQIVNRMTLDEKLGQMLMPDFRNWQ
KEGESSPQAFTEMNEEVAGLIKKYQFGGVILFAENVKTTQQTVQLTDAYQKASPKIPLML
SIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGTIIGKELSALGINTDFSPVMDIN
NNPDNPVIGVRSFSSNRELTARLGLYTMKGLQRQDIASALKHFPGHGDTDVDSHYGLPLV
SHSQERLREVELYPFQRAIDAGADMVMTAHVQFPAFDDTTYKSKLDGSDILVPATLSKKV
MTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAIKAGVDIALMPASVTSLKEEQK
YARVIQALEEAVKNGDIPEHQINKSVERIISLKIKRGMYPARNDDSIKEKIDKAQKIVGS
KHHLKAEKKIAEKAVTVLKNEQHTLPFKPKKDSRILIVAPYEEQTASIEQTIRDLVKRKK
IKPVSLSKMNFANQVFNAEHEKQVKEADYIITGSYVVKNDPVVNDGVIDDTISDSSKWAT
VFPRAVMKATLQHNKPFVLMSLRNPYDAANFEEAKALIAVYGFKGYANGRYLQPNIPAGV
MAIFGQVKPKGTLPVDIPSVTKPGDILYPYGYGLNIKTGKPL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtatttccgcttatcctttcagccgttctctttttttcatgttttcttggc
gccagtcagacaaaagctacttcatccagcggctcagctgacgccaagcagattgtcaat
cgcatgacgttagatgaaaaactcggccagatgctgatgcctgatttcagaaattggcaa
aaggagggcgagtcttctccgcaagccttcacagaaatgaatgaggaagtcgcaggcctt
atcaagaagtatcaattcggcggcgtcatcctttttgcagaaaatgtaaaaacaacacag
caaactgtacagcttactgacgcttaccaaaaggcgagccccaaaattccgctcatgctg
agtattgatcaggaaggcggtatcgtaacgagattaggggagggcactaatttcccaggg
aatatggcgctgggcgcagctagaagcagaatcaacgcctatcagaccggcaccattatt
ggaaaggagctctctgccttaggcattaatacggatttcagccccgtcatggacattaat
aataatcctgataatccggtaatcggcgtacggtcattcagctctaatcgagaactgaca
gcacgactcggtttatatacgatgaaaggtttgcagcggcaagatatcgcctctgccctc
aaacatttcccgggacatggagacacggacgttgacagccattacggactgccgctcgtt
tcccatagccaagaacggcttcgtgaggtcgagctctatccttttcaaagagcaattgat
gccggtgctgatatggtgatgacagctcacgttcaatttcctgcctttgacgacaccaca
tacaaaagcaaactcgatggatcggacattttggtgcctgctacactctcgaaaaaagtg
atgacaggtcttcttcgtcaggaaatgggctttaatggcgtcatcgttactgacgctctc
aatatgaaagcaatcgcagatcatttcggacaggaagaggctgttgtcatggctataaaa
gccggtgtcgatattgcattaatgcctgcctcagttacttctctgaaagaagaacagaaa
tacgcacgtgttattcaagctttagaagaagccgtaaaaaacggagacattccggaacat
caaatcaacaaatcggttgaaagaatcatttccctgaaaataaaacgcggtatgtatcca
gctcgaaacgacgacagcataaaagaaaaaatagacaaagcccagaaaatcgtaggaagc
aagcatcacctgaaagcggagaaaaaaatagctgaaaaagcagtgaccgtattaaaaaat
gaacagcacaccttgccgttcaagcctaaaaaagacagccggatcttaattgtcgcgcct
tacgaagaacaaacggcttcgattgaacaaaccattcgcgatctcgtcaaacgaaagaaa
atcaaacccgtgtccctcagcaaaatgaattttgccaaccaagtatttaatgccgagcat
gaaaaacaagtaaaagaggctgattatatcataaccggctcctatgtcgtgaaaaatgac
cctgtcgtcaacgacggtgtcatcgacgacaccatatcagattcaagcaaatgggccacc
gtatttccgagagctgtgatgaaagccacactgcagcacaacaaaccatttgtcttaatg
agcctgcgcaacccatatgatgccgccaattttgaagaagctaaggcactcattgctgtc
tatggctttaaaggatacgcgaatggccgttatcttcaaccaaatatccccgccggagtt
atggcgatattcggccaggtaaaacctaaaggcacacttccagttgacattccgtcagtc
acgaaaccgggagacatcctttatccatatggctatggattaaatatcaaaacgggaaaa
ccactctaa

DBGET integrated database retrieval system