KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_00860Help
Entry
BSUW23_00860      CDS       T01302                                 

Gene name
ybbD
Definition
(GenBank) putative beta-hexosaminidase, putative lipoprotein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00520  Amino sugar and nucleotide sugar metabolism
bss01100  Metabolic pathways
bss01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSUW23_00860 (ybbD)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BSUW23_00860 (ybbD)
Enzymes [BR:bss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BSUW23_00860 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C AAA_12
Motif
Other DBs
NCBI-ProteinID: ADM36229
UniProt: E0U058
Position
complement(175955..177883)
Genome map
AA seq 642 aa AA seqDB search
MKPVFPLILSAVLFFSCFLGASQTKATSSSGSADAKQIVNRMTLDEKLGQMLMPDFRNWQ
KEGESSPQAFTEMNEEVAGLIKKYQFGGVILFAENVKTTQQTVQLTDAYQKASPKIPLML
SIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGTIIGKELSALGINTDFSPVMDIN
NNPDNPVIGVRSFSSNRELTARLGLYTMKGLQRQDIASALKHFPGHGDTDVDSHYGLPLV
SHSQERLREVELYPFQRAIDAGADMVMTAHVQFPAFDDTTYKSKLDGSDILVPATLSKKV
MTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAIKAGVDIALMPASVTSLKEEQK
YARVIQALEEAVKNGDIPEHQINKSVERIISLKIKRGMYPARNDDSIKEKIDKAQKIVGS
KHHLKAEKKIAEKAVTVLKNEQHTLPFKPKKDSRILIVAPYEEQTASIEQTIRDLVKRKK
IKPVSLSKMNFANQVFNAEHEKQVKEADYIITGSYVVKNDPVVNDGVIDDTISDSSKWAT
VFPRAVMKATLQHNKPFVLMSLRNPYDAANFEEAKALIAVYGFKGYANGRYLQPNIPAGV
MAIFGQVKPKGTLPVDIPSVTKPGDILYPYGYGLNIKTGKPL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtatttccgcttatcctttcagccgttctctttttttcatgttttcttggc
gccagtcagacaaaagctacttcatccagcggctcagctgacgccaagcagattgtcaat
cgcatgacgttagatgaaaaactcggccagatgctgatgcctgatttcagaaattggcaa
aaggagggcgagtcttctccgcaagccttcacagaaatgaatgaggaagtcgcaggcctt
atcaagaagtatcaattcggcggcgtcatcctttttgcagaaaatgtaaaaacaacacag
caaactgtacagcttactgacgcttaccaaaaggcgagccccaaaattccgctcatgctg
agtattgatcaggaaggcggtatcgtaacgagattaggggagggcactaatttcccaggg
aatatggcgctgggcgcagctagaagcagaatcaacgcctatcagaccggcaccattatt
ggaaaggagctctctgccttaggcattaatacggatttcagccccgtcatggacattaat
aataatcctgataatccggtaatcggcgtacggtcattcagctctaatcgagaactgaca
gcacgactcggtttatatacgatgaaaggtttgcagcggcaagatatcgcctctgccctc
aaacatttcccgggacatggagacacggacgttgacagccattacggactgccgctcgtt
tcccatagccaagaacggcttcgtgaggtcgagctctatccttttcaaagagcaattgat
gccggtgctgatatggtgatgacagctcacgttcaatttcctgcctttgacgacaccaca
tacaaaagcaaactcgatggatcggacattttggtgcctgctacactctcgaaaaaagtg
atgacaggtcttcttcgtcaggaaatgggctttaatggcgtcatcgttactgacgctctc
aatatgaaagcaatcgcagatcatttcggacaggaagaggctgttgtcatggctataaaa
gccggtgtcgatattgcattaatgcctgcctcagttacttctctgaaagaagaacagaaa
tacgcacgtgttattcaagctttagaagaagccgtaaaaaacggagacattccggaacat
caaatcaacaaatcggttgaaagaatcatttccctgaaaataaaacgcggtatgtatcca
gctcgaaacgacgacagcataaaagaaaaaatagacaaagcccagaaaatcgtaggaagc
aagcatcacctgaaagcggagaaaaaaatagctgaaaaagcagtgaccgtattaaaaaat
gaacagcacaccttgccgttcaagcctaaaaaagacagccggatcttaattgtcgcgcct
tacgaagaacaaacggcttcgattgaacaaaccattcgcgatctcgtcaaacgaaagaaa
atcaaacccgtgtccctcagcaaaatgaattttgccaaccaagtatttaatgccgagcat
gaaaaacaagtaaaagaggctgattatatcataaccggctcctatgtcgtgaaaaatgac
cctgtcgtcaacgacggtgtcatcgacgacaccatatcagattcaagcaaatgggccacc
gtatttccgagagctgtgatgaaagccacactgcagcacaacaaaccatttgtcttaatg
agcctgcgcaacccatatgatgccgccaattttgaagaagctaaggcactcattgctgtc
tatggctttaaaggatacgcgaatggccgttatcttcaaccaaatatccccgccggagtt
atggcgatattcggccaggtaaaacctaaaggcacacttccagttgacattccgtcagtc
acgaaaccgggagacatcctttatccatatggctatggattaaatatcaaaacgggaaaa
ccactctaa

DBGET integrated database retrieval system