KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_00970Help
Entry
BSUW23_00970      CDS       T01302                                 

Gene name
rhiB
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSUW23_00970 (rhiB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSUW23_00970 (rhiB)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BSUW23_00970 (rhiB)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BSUW23_00970 (rhiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
202505..203806
Genome map
AA seq 433 aa AA seqDB search
MKLVCIDCGQEMSSDDFKYQCSCGGLVDIVHDFSHYDTDHLKHVFHERLSERMSVFASGV
WRYKELIYPDLPVESIVTKYEGNTGLYRSEMLSKYTGVRKVYLKAQSENPSGSFKDNGMT
VAVSHGKHLGYEKYACTSTGNTSSSLGMYASIANASSYVFVPDKEISINKVLQTAAYGGN
VFSIPGTYDDGIRFLEKYSGDFGFYICNSINPFRIEGQKSIIYEIAQYLDWKLPDWIIVP
GGALSNATALGKGLRDLYALNFIDKIPRVAIIQAEGASPFHQMISKNKETIDPEPFPYTR
ASALNIGNPPSWKKARKVLEDTNGITVSVTDEDILDAKAIIDRTGVGCEPASASTAAGLR
QLRSQQVIDKDESVLCILTGNILKDTGALHDYHFGKDLNGKFKNNIKSAELSFGKIKSAM
ETIRDLNGLLKIH
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtatgtattgactgtggacaggaaatgtcttctgatgattttaagtatcaa
tgttcttgtggtggactggttgatattgttcatgatttttctcattacgataccgaccat
ttaaagcatgtatttcatgaacgtctatctgaacgtatgtctgtttttgcaagcggagta
tggagatacaaagagcttatatatccagatttgccagttgagagtattgttacaaaatat
gaagggaacacagggttataccgctctgagatgctatcgaaatataccggagtgagaaag
gtatatctaaaggcgcaaagtgaaaaccccagcggttcgtttaaggataacggcatgact
gttgctgtttcacatggaaaacatttaggttatgaaaaatacgcctgtacttctaccgga
aacacttcttcatcattgggaatgtatgcttctattgcaaatgcttcatcctacgttttt
gtaccggataaagaaatttcaattaataaagtattgcagacagcagcttacggtggaaac
gtattcagtattccgggaacttatgatgacggtatcaggtttttggaaaagtatagtggt
gattttggtttttatatatgcaattctattaaccctttcagaattgaaggccaaaagagc
attatttatgagatagctcaatatctagactggaaattgcctgattggattattgttcct
ggcggtgctcttagcaatgcaacggctttagggaaaggactccgcgatttatatgcttta
aacttcatagacaagatacctcgggtagctatcatacaagcggaaggcgccagtccattt
catcaaatgattagtaaaaataaagaaacaattgacccggaaccatttccgtacactaga
gcttctgcattgaatataggaaatcctcctagctggaaaaaagcgagaaaggttttggaa
gatacaaatggaatcactgtttctgttacagatgaggacattcttgatgcaaaagcaata
atcgacagaacaggagtgggctgtgagcctgcctctgcctctactgcagcaggactccgt
caattgaggtcacagcaggtaatagacaaagatgaatctgttttgtgtattttaacaggc
aatatattaaaagatactggggctctccacgattaccactttggaaaagatttgaacggc
aagtttaaaaacaatattaaatctgccgagctatcatttggaaagataaaatcagcgatg
gagacgattcgtgatttgaatggtttattaaagattcattaa

DBGET integrated database retrieval system