KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_00970Help
Entry
BSUW23_00970      CDS       T01302                                 

Gene name
rhiB
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00260  Glycine, serine and threonine metabolism
bss00750  Vitamin B6 metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01230  Biosynthesis of amino acids
Module
bss_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSUW23_00970 (rhiB)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BSUW23_00970 (rhiB)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BSUW23_00970 (rhiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP COX5B RINGv
Motif
Other DBs
NCBI-ProteinID: ADM36251
UniProt: E0U080
Position
202505..203806
Genome map
AA seq 433 aa AA seqDB search
MKLVCIDCGQEMSSDDFKYQCSCGGLVDIVHDFSHYDTDHLKHVFHERLSERMSVFASGV
WRYKELIYPDLPVESIVTKYEGNTGLYRSEMLSKYTGVRKVYLKAQSENPSGSFKDNGMT
VAVSHGKHLGYEKYACTSTGNTSSSLGMYASIANASSYVFVPDKEISINKVLQTAAYGGN
VFSIPGTYDDGIRFLEKYSGDFGFYICNSINPFRIEGQKSIIYEIAQYLDWKLPDWIIVP
GGALSNATALGKGLRDLYALNFIDKIPRVAIIQAEGASPFHQMISKNKETIDPEPFPYTR
ASALNIGNPPSWKKARKVLEDTNGITVSVTDEDILDAKAIIDRTGVGCEPASASTAAGLR
QLRSQQVIDKDESVLCILTGNILKDTGALHDYHFGKDLNGKFKNNIKSAELSFGKIKSAM
ETIRDLNGLLKIH
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtatgtattgactgtggacaggaaatgtcttctgatgattttaagtatcaa
tgttcttgtggtggactggttgatattgttcatgatttttctcattacgataccgaccat
ttaaagcatgtatttcatgaacgtctatctgaacgtatgtctgtttttgcaagcggagta
tggagatacaaagagcttatatatccagatttgccagttgagagtattgttacaaaatat
gaagggaacacagggttataccgctctgagatgctatcgaaatataccggagtgagaaag
gtatatctaaaggcgcaaagtgaaaaccccagcggttcgtttaaggataacggcatgact
gttgctgtttcacatggaaaacatttaggttatgaaaaatacgcctgtacttctaccgga
aacacttcttcatcattgggaatgtatgcttctattgcaaatgcttcatcctacgttttt
gtaccggataaagaaatttcaattaataaagtattgcagacagcagcttacggtggaaac
gtattcagtattccgggaacttatgatgacggtatcaggtttttggaaaagtatagtggt
gattttggtttttatatatgcaattctattaaccctttcagaattgaaggccaaaagagc
attatttatgagatagctcaatatctagactggaaattgcctgattggattattgttcct
ggcggtgctcttagcaatgcaacggctttagggaaaggactccgcgatttatatgcttta
aacttcatagacaagatacctcgggtagctatcatacaagcggaaggcgccagtccattt
catcaaatgattagtaaaaataaagaaacaattgacccggaaccatttccgtacactaga
gcttctgcattgaatataggaaatcctcctagctggaaaaaagcgagaaaggttttggaa
gatacaaatggaatcactgtttctgttacagatgaggacattcttgatgcaaaagcaata
atcgacagaacaggagtgggctgtgagcctgcctctgcctctactgcagcaggactccgt
caattgaggtcacagcaggtaatagacaaagatgaatctgttttgtgtattttaacaggc
aatatattaaaagatactggggctctccacgattaccactttggaaaagatttgaacggc
aagtttaaaaacaatattaaatctgccgagctatcatttggaaagataaaatcagcgatg
gagacgattcgtgatttgaatggtttattaaagattcattaa

DBGET integrated database retrieval system