KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_01675Help
Entry
BSUW23_01675      CDS       T01302                                 

Gene name
nasF
Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00860  Porphyrin and chlorophyll metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSUW23_01675 (nasF)
Enzymes [BR:bss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BSUW23_01675 (nasF)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BSUW23_01675 (nasF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: ADM36392
UniProt: E0U1P4
Position
complement(338811..340256)
Genome map
AA seq 481 aa AA seqDB search
MKNGIVYFVGAGPGDPGLLTIKGKQALEEADVILYDRLANPKLLEFASPDCQFIYCGKLP
DRHFMKQREINALLVEKASMGLTVVRLKGGDPSVFGRVGEEADALHEHGIRYEMVPGITS
GIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEGLARSVQTLVFYMGVKNLSY
ICQQLIAYGKSPSVPVIVVQWGTWGRQRSVKGSLENIQQKVQEHQITNPAIIVIGDIVNF
QTHSWFESKPLIGQHIMVVTHGEDEDPLADKLRASGADVIEWPKWRTENMPVNEEILRKI
GTFEDIFFTSHHAVCEFFQALTSKKIDIRQLTARLSATSEHAETELKKRGFLISAIQPDS
EKRLVVGSRHAVENIQKHESCSFYITHENVIDDRFTHMIQRTISESPLHMIICPSKPSTQ
QLISAGEQIGISPEPSASRPPIVCISDNSAAGAYGFTAVQEQDELFALIQNQQAEKKLLH
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacggaattgtatatttcgtgggagcgggtcccggtgatccagggctgcttacc
atcaaaggaaaacaggcgctggaggaagcagatgttattttatatgaccgactcgccaac
ccgaagctgctcgaattcgcatcaccggactgccagtttatttattgcggaaaactgcca
gaccgccattttatgaaacaaagagaaatcaacgccctgctggttgaaaaagcatcaatg
gggttaaccgttgtccgtttaaaaggcggagatccgagtgtattcggcagagtcggagag
gaagcagatgctctccatgagcacggcatccgttatgaaatggtgccggggatcacttct
ggaattgcagcgccgctatacgcgggcatccccgttacgcatcgggatttcgcatcgtct
tttgccatgattactgcgcatgataaatcattaaaaggcacgccgaatctcgactgggaa
ggacttgcccggagcgttcaaacccttgtcttttacatgggcgtcaagaatttatcttat
atttgccagcagctcatcgcatacggaaaatcgccttctgtccctgtcattgtggtccaa
tggggtacgtggggccgccagcggagcgtgaaaggatcgcttgagaacattcagcaaaaa
gtacaggaacaccagatcacaaaccctgcgattatcgtcatcggagatatcgtcaatttt
caaacacacagctggtttgaaagcaaaccactcatcggccagcacatcatggttgtcact
catggcgaagatgaagacccgcttgcagacaagctgcgtgcttccggtgccgatgtcatc
gaatggccgaaatggcggactgagaacatgcctgtcaatgaagagattcttcgaaagatc
ggcacctttgaagacatttttttcacgtcgcaccatgcggtttgtgaatttttccaagcg
ctgacttctaagaaaatcgacatccgccagctgacagcccgactaagtgcgacatctgaa
catgcagagacggagcttaaaaaacggggtttcctcatatcagccattcagcctgattca
gaaaaacgtcttgtggtcgggagccggcatgcagtggaaaacatacagaagcatgagtcc
tgttcgttttatatcactcatgaaaacgtcatagatgaccggttcacccacatgattcag
cgaaccatcagtgaatctccgctgcacatgatcatatgcccgagcaaaccgtccactcag
caattgatcagcgcaggcgaacaaattggcatttcgccggaaccatcagcaagccggcct
cctatcgtctgcataagcgataactcagctgccggcgcttatggattcacagctgtccaa
gaacaggatgaattgtttgctttgattcaaaatcaacaggcggaaaaaaagcttcttcac
agctga

DBGET integrated database retrieval system