KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_01765Help
Entry
BSUW23_01765      CDS       T01302                                 

Gene name
bglC
Definition
aryl-phospho-beta-d-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bss00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
357391..358824
Genome map
AA seq 477 aa AA seqDB search
MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKATNGDIAVDH
YHRYKEDVALMAEMGLKAYRFSVSWPRIFPNGKGEINEAGLAFYDNLIDELLSHHIEPVL
TLYHWDLPQALMDEYGGFESRNIIEDFNNYCITLYKRFGDRVKYWVSLNEQNYNFNHGFI
TAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPDGKIGPSFAYSPAYPLSSHPEDI
LAFENAEEFMNNWWLDMYCWGTYPQIPFRYLEKQGWAPTIEAGDMELLAKGKPDFVGVNY
YQTITYERNPLNGVSEGKMNTTGQKGTNQETGIPGVFKTKKNPHLTTSNWDWTIDPIGLR
IGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRIDYLRSHLEQCRQAISDGVDLIG
YCSWSFTDLLSWLNGYQKRYGFVYVNRDEENTHDLKRLKKKSFYWYQDVIKTNGESL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatccaccagcatccagaatcttttccgaaacattttttgtggggctctgcttcagca
gcgtaccagattgaaggcgcttggaacgaagatggcaaaggcccttctgtatgggatgta
tttacgaaaataccgggcaaaacgtttaaagcgaccaatggcgatattgcggttgaccat
tatcaccgttataaagaagatgtcgctttgatggctgagatgggattaaaagcgtatcga
ttttccgtcagctggccgcggatttttccaaatggaaaaggggagatcaatgaagcaggc
ctagcgttttacgataacctgattgacgagttgctttctcatcacattgagccagttctg
actttatatcactgggatttgcctcaggctcttatggacgagtatggtggttttgaatca
agaaacatcatagaggattttaataactactgtattactctttataaacgttttggagac
agagtgaaatattgggtatcgttaaacgaacagaattacaattttaatcacggctttatt
acagccatgcacccgcctggagtgaaagacagaaaacgattttatgaagcaaaccatatt
gcgtttctcgctaatgcgaaagccattgaatcttttagggaatatgtgcctgatggcaaa
atcggtccaagctttgcttattctccggcttaccctttatccagccatccagaggatata
ctggcatttgaaaacgctgaagaatttatgaacaattggtggctggacatgtattgctgg
ggaacctacccgcaaattcctttccgctatttagaaaaacaaggctgggcgccgacaatc
gaagcaggagatatggagctgcttgccaaaggaaagcctgattttgtaggtgtcaattat
tatcagaccatcacctacgaacgaaatccgcttaatggtgtgtcggaagggaaaatgaat
acgacaggccaaaaggggaccaaccaggaaacagggatacccggagtgtttaaaacgaaa
aaaaatccgcacctgacaacgagcaactgggattggacaattgacccaatcggattgcgt
atcggtcttcgccgaattacaagccgctatcagcttccagtgtttatcacagagaatggt
ttgggtgaatttgataaagttgaggacgggactgtacaggatgattatcgaattgattat
ttgcgttcgcatcttgagcaatgcagacaagccatcagcgatggtgtcgatttgatcggc
tattgcagctggtcgtttactgatctattaagctggctgaatggttaccaaaaaagatac
ggattcgtttatgttaatcgcgatgaagaaaatacacatgatttaaaacgcttgaagaaa
aaaagcttttattggtatcaggatgtaatcaagacgaacggagaaagtttataa

DBGET integrated database retrieval system