KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_02380Help
Entry
BSUW23_02380      CDS       T01302                                 

Gene name
murF
Definition
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
Orthology
K01929  
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BSUW23_02380 (murF)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSUW23_02380 (murF)
Enzymes [BR:bss01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     BSUW23_02380 (murF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
497465..498838
Genome map
AA seq 457 aa AA seqDB search
MIKRTVKNIAKMVKGTLTNPQYEQTVIHGVATDTRKLEQHQLFIPLKGEHFNGHTFVPQA
FEAGVAAVLWDRSEPNPPENQAVILVDDTLSALQQLAKAYLQELGTRVIGVTGSNGKTTT
KDMIHAVLGTRYRVHKTGGNFNNHIGLPLTVLAMPEDTEIAVLEMGMSAKGEIDLLSRLA
NPDAAVITNIGESHMQDLGSREGIAEAKLEIINGLKEDGVLIYIGDEPLLQKTYSCQTKT
YGAGAQNDYQLQDVSQSEEGTHFTIKGMEKTFFIPILGKHNVMNAMAAIAAGAYFGITPE
DAAKGLSGLKVTGMRLELIKTDSGISIINDAYNASPTSMKAAIQLTESLEGYGKKMLVLG
DMLELGDLEETFHKECGAVISPEKIDRVFTYGKLGAFIAEGALKHFEKERVSHYTEKKDL
LQAVKENASKGDLILFKASRGMKLEEIVKDLIESPLS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaacgaacagtaaagaacattgccaagatggtcaaaggcacactgacaaatccg
caatatgaacaaacagtcattcatggagtggcaactgatacaagaaaactggaacaacat
cagcttttcatcccgctgaaaggggaacattttaacggccacacttttgtgccgcaggct
tttgaagccggtgtggcagccgttctttgggatcggtcagaaccaaatccgcccgagaat
caagccgtcatcttagtggatgacaccctttccgctcttcagcagcttgcaaaagcttat
ttgcaggagcttggcacacgtgtcatcggggtaaccggaagcaatggcaaaacgacaacg
aaagatatgattcacgccgtcctgggaacccggtaccgtgtccacaaaacaggaggaaac
ttcaataatcacatcggtctgccgctgacggttttagccatgcctgaagatacggagatc
gctgtattggagatgggaatgagcgccaaaggagaaattgatctcctgtcccgcctggca
aacccggatgcggcagtcattacgaatatcggcgaatcccacatgcaagaccttggctca
agagaaggcatcgcggaggcgaagctagaaatcattaatgggctaaaagaagacggagtg
ctgatttatatcggggacgaaccgctccttcaaaaaacatacagctgccaaacgaaaacg
tacggagcaggagcgcaaaatgattatcagcttcaggatgtcagccagagtgaggaagga
actcattttacaatcaaaggaatggaaaaaacgttttttattccgatactcggcaagcac
aatgtcatgaacgccatggctgcgattgctgctggggcttatttcggcattacgcctgag
gatgcagcaaagggactgagcggactaaaggtaaccggcatgagacttgaactcatcaaa
acagacagcggcatatcgataatcaatgacgcttataatgcgagtccgacttccatgaag
gctgccattcaattgacagaaagccttgaaggctacggaaaaaaaatgctcgtactcggc
gatatgcttgaactcggcgatcttgaagaaacgttccataaagagtgcggcgccgtgatc
agccctgagaaaatcgatcgtgtctttacgtacggaaaactgggagcatttattgcggaa
ggcgcactgaaacactttgagaaagaacgcgtcagccattacactgagaaaaaagatctc
ctccaagctgtgaaggaaaacgcgtcaaaaggagatttaattttattcaaagcgtccaga
ggtatgaagcttgaagaaatcgttaaagatttaatagagagcccgctttcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system