KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_03690Help
Entry
BSUW23_03690      CDS       T01302                                 

Gene name
cypD
Definition
bifunctional P-450/NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BSUW23_03690 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BSUW23_03690 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSUW23_03690 (cypD)
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BSUW23_03690 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BSUW23_03690 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
761962..765147
Genome map
AA seq 1061 aa AA seqDB search
MKETSPIPQPKTYGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHEK
MVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDFQDKLMVRTKRQFHHDIQTMFSLVDSIIAERRSNGDQDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPDKLKKAYEEVDRV
LTGAAPTYKQVLELKYIRMILNESLRLWPTAPAFSLYPKEDTVIGGKYMITTQDRISVLI
PQLHRDQDAWGEDAEEFRPERFEHQDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMV
LKYFTLIDHENYELDIKQTLTLKPGDFRIRVQTRHQEAIHTDVPAAEKEAPVEQKEETET
KGASVIGLNNRPLLVLYGSDTGTAEGVARELADTASLHGVRTEVAPLNDRIGKLPKEGAV
VIVTASYNGKPPSNAGQFVQWLQEIKPGELEGVHYAVFGCGDHNWASTYQYVPRFIDEQL
AEKGATRFSERGEGDVSGDFEGQLDEWKKSMWTDAIKAFGLELNENADKERSTLSLQFVR
GLGESPLARSYEAAHASIAENRELQSADSDRSTRHIEIALPPDVEYREGDHLGVLPRNSQ
TNVSRILHRFGLKGTDQVTLSASGRSAGHLPLGRPVSLHDLLSYSVEVQEAATRAQIREL
AAFTVCPPHKRELEDMTEEGVYQEQILKKRISMLDLLEQYESCEMPFERFLELLRPLKPR
YYSISSSPRVNPEQASITVGVVRGPAWSGRGEYRGVSSSYLAERQAGDDVVMFVRTPESR
FQLPEDPETPIIMVGPGTGVAPFRGFLQARAALKREGKALGEAHLYFGCRNDHDFIYRDE
LEQFEKDGIVTVHTAFSRKEGMPKTYVQHLMADHAETLISILDRGGRLYVCGDGSKMAPD
VEAGLQKAYQSVHGTGEEEAQNWLKHLQDTGIYAKDVWSGV
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaagcccgattcctcagccgaagacttatggtccgctcggcaatctacct
ttaattgataaagacaaaccgacactgtcgctgatcaaattggcagaagagcagggcccg
atttttcaaatccatacacctgcgggcacgacgattgtagtgtccggacacgaattggtg
aaagaagtttgtgatgaagagcgattcgacaaaagcattgaaggcgccttggagaaggtt
cgcgcgttttccggtgacggattgtttacaagctggacacatgagcctaattggagaaaa
gcgcataacattctgatgccgacgttcagccagcgggccatgaaagactaccatgagaaa
atggtcgatatcgccgttcagctcattcaaaaatgggccagactcaatccgaatgaagca
gtcgatgtcccaggggatatgacgagactgacgctcgacacaattgggctgtgcgggttt
aactatcgttttaacagctactacagagaaacgccacacccatttatcaacagcatggta
cgggcgctggatgaagcgatgcaccagatgcagcggcttgattttcaagataagcttatg
gtcagaacaaagcgccaattccatcatgatattcaaacaatgttttcattagtcgacagc
attattgccgagcggagatcaaatggagatcaggatgaaaaagatttgcttgcccgcatg
ctgaatgtggaagatccggaaacaggtgaaaagctcgacgatgaaaatatccgctttcaa
atcattacgtttttgattgccgggcatgaaaccacgagcggactcctttcctttgcgatc
tactttttattgaagcatcctgacaaactgaaaaaggcgtatgaagaggtcgaccgggtg
ctgacaggtgcagcgccaacctataaacaagtgctcgagctgaaatacatacggatgatt
ttaaatgaatcactgcgcttatggccgacggctccggctttcagcctttatccaaaagaa
gacacagtcattggcggaaagtacatgattacaacccaagatagaatttctgtgctgatt
ccgcagcttcatcgtgatcaggacgcttggggagaggacgctgaagaattccgtccagaa
cggtttgaacatcaggaccaagtgcctcatcatgcgtacaaaccgttcggaaatggacag
cgggcctgtatcggcatgcagtttgcccttcatgaagccacacttgtgctgggcatggtc
ttaaaatatttcacgttaattgatcatgagaattatgagcttgatatcaaacaaacctta
acactcaagcctggcgattttcgtatcagggttcaaacacggcatcaggaagccattcat
acggacgttccggcagctgaaaaagaggcgcctgttgagcaaaaagaggaaacggaaaca
aagggtgcatcggtcatcggcctcaacaaccggccgcttcttgtgctgtacggatcagat
accggcaccgcagaaggcgtagcccgcgagcttgccgatacagccagtcttcatggcgta
aggactgaagtcgcacctctgaacgaccggattggaaagctgccgaaagagggagcggtt
gtcattgtgaccgcgtcctataacggaaaaccgccaagcaatgccggacagttcgtgcag
tggcttcaagaaatcaaaccgggtgagcttgagggcgtccattacgcggtatttggctgc
ggcgaccacaactgggcgagcacgtatcagtacgtgccgagattcattgatgagcagctt
gcagagaaaggcgcgactcggttttctgagcgcggagagggtgatgtaagcggtgatttt
gaagggcagcttgacgagtggaaaaaaagcatgtggacagacgccatcaaagcattcgga
cttgagcttaatgaaaacgccgataaggaacgaagcacgctgagccttcagtttgtcaga
gggcttggagagtcaccgctggcccgatcgtacgaagctgctcacgcatccatcgccgaa
aatcgtgaactccagtccgcagacagtgatcgcagtacccgccatatcgaaatcgcattg
ccgccggatgttgaatatcgggagggcgaccaccttggcgtattgccgaggaacagccaa
accaatgtcagccggatacttcaccgcttcggcctgaagggaaccgatcaagtgacattg
tcagcaagcgggcgcagtgcggggcatctgccattagggcgtcctgtgagccttcatgat
cttctcagctacagcgtcgaggtgcaggaagcggcaactagggcgcaaatacgcgagctg
gccgcatttaccgtctgtccgcctcataaacgtgaattggaagatatgacggaagagggc
gtttatcaggaacaaattttgaaaaaacggatttctatgctggatctgctcgagcaatat
gaatcatgtgaaatgccgtttgaacggtttttagagcttttacggccgttaaaaccgaga
tattattcgatttcaagctctccaagggtaaatcctgagcaggcatccattacagttggt
gtcgtgcgcggccctgcgtggagcggccgcggcgaatacaggggtgtttcttcaagttac
ttagctgagcgccaagcgggtgatgatgtcgtgatgtttgtccgcacaccggaatcccgg
tttcagcttccggaagaccctgaaaccccaatcattatggtcgggccgggcacaggagta
gcgccattccgcggtttcctccaagcacgcgcagctttaaagcgggagggaaaagcgctc
ggcgaagctcatctctattttggatgcaggaacgatcatgattttatttaccgtgacgag
cttgagcagtttgaaaaagatggaatcgtcactgtccacacagccttttcccgaaaagaa
ggcatgccgaaaacgtatgtccagcatctcatggctgaccatgcagaaacattgatttcg
attcttgatcgcggaggcaggctctatgtatgcggtgatggcagcaaaatggccccagat
gtggaggccggactgcaaaaagcgtatcagtctgttcatggaactggtgaagaagaagca
caaaactggctaaaacatctgcaggataccggtatatatgcaaaagatgtttggtcgggg
gtttaa

DBGET integrated database retrieval system