KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_05130Help
Entry
BSUW23_05130      CDS       T01302                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSUW23_05130 (hemY)
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BSUW23_05130 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049582..1050994
Genome map
AA seq 470 aa AA seqDB search
MSDGKKHVVIIGGGITGLAAAFYMEKEIIEKNLPLELTLVEASPRVGGKIQTVKKDGYII
ERGPDSFLERKTSAPQLVKDVGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKIAP
FVSTGLFSVSGKARAAMDFILPASKSKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLVEE
IEKQLKLTKVYKGTKVTKISRGGTGYSLELDNGVTLDAESVIVTAPHKAAAGMLSELPAI
SHLKNMHSTSVANVALGFPEGAVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGH
KQRIKELREALSTAYPGVYVTGASFEGVGIPDCIDQGKAAVSDALTYLFS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggcaaaaaacatgtagtcatcatcggcggcggcattaccggtttagccgcc
gccttctatatggaaaaagaaatcatagaaaaaaatcttccccttgagctgacgcttgtt
gaggcaagtccgagagtcggcgggaaaatccaaactgtcaagaaagacggctatatcatc
gaaagagggcctgattcatttctggaacggaagacaagcgctccgcagcttgtcaaagat
gtcggccttgaacatttgcttgtcaacaatgcaacaggacaatcctatgtgcttgtaaac
cgcaccctgcatccaatgccgaagggcgccgtgatggggataccgacaaaaattgcgccg
ttcgtttcaaccggtctgttttctgtgtctgggaaggcaagggccgctatggatttcatt
ctgcctgcaagcaagtcaaaagacgaccagtcattgggagaatttttccgcaggcgtgtc
ggagatgaagtggttgagaatttaatcgagccgcttctatcaggcatctacgctggcgac
attgacaagcttagtctaatgtcgacttttccgcaattttaccagacggaacaaaagcac
agaagcttaattctcggcatgaaaaaaacaaggcctcaaggctccggccagcagctcacg
gctaaaaagcaagggcagttccagaccctttcaacgggcttgcagactcttgtcgaagag
attgaaaagcaattaaagctgacgaaggtatacaaagggacaaaagtgaccaagatcagc
cgcggcggcactggctactcgctcgaactggataacggcgtcacacttgatgctgaatca
gtgattgtgactgctccgcataaagcggctgcaggaatgctttctgagcttcctgccatt
tctcatttgaaaaatatgcactccacatccgtggcaaatgtcgccttgggcttccctgaa
ggcgccgtccaaatggagcacgagggaacgggctttgttatctcaagaaacagtgatttc
gcgatcacagcctgtacgtggacgaacaaaaaatggccgcacgcagcgcctgaaggcaaa
acgctgcttcgggcatatgtcggaaaagccggagacgaatcgattgtcgatctctcagat
aacgacattatcaacattgtgttagaagacttaaagaaagtcatgaacataaacggggag
ccggaaatgacatgtgtcacccgctggcatgaaagcatgccgcagtaccatgtcggccat
aagcagcgcatcaaagaactgcgcgaagcactgagcaccgcatatccgggtgtctacgtg
acaggcgcttcttttgaaggtgttggaattcccgactgcatcgatcaaggaaaagctgcc
gtgtctgacgcgcttacctatttattcagttaa

DBGET integrated database retrieval system