KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_05470Help
Entry
BSUW23_05470      CDS       T01302                                 

Gene name
asnO
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSUW23_05470 (asnO)
Enzymes [BR:bss01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BSUW23_05470 (asnO)
Peptidases [BR:bss01002]
 Cysteine Peptidases
  Family C44
   BSUW23_05470 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1119523..1121367
Genome map
AA seq 614 aa AA seqDB search
MCGITGWVDFKKQLVQEKQTINRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDIEGGR
QPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVDH
LNGIFAFAVWDEKRDLLFAARDRLGVKPFFYTKQGSSFLFGSEIKAILAHPDIKAQVDRT
GLSEIFGLGPSRTPGSGVFKGIKEVRPAHALTFSKDGLNIWRYWNVESEKHTDSFDDTVA
NVRSLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKGGKAPLHTYSIDYEEND
KFFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKNLVDHLEEAVLVKDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHMADVESGFPWMRSTEERIKLLSDSWQKK
LNLKEYVNAKYEETLAETPLLDGETGVDKARRQLFYLNMLWFMTNLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWEMKMHDNREKGILRKALEGILPDDILYRKKSPYPKTHHPEY
TKGVSEWLKTIRSQKDSVLHTLLDRKQLDQLLETEGSSFKVPWFGQLMKGPQLIAHLAQI
HTWFEAYRIDIDEG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattacgggttgggtcgattttaaaaagcagctcgtccaggaaaaacaaacg
atcaacagaatgacagacactctttccaaacgggggcctgatgattctaacgtttgggga
gagcaccatgttttattcggacataaaaggcttgcggttgtcgatattgaaggcggacgc
cagccgatggcatgcacctataaaggggatacgtacaccattatttacaatggtgagctg
tataacacggaggacctgcgcaaagaattgcgggcgcggggccatcaattcgagcgtacg
tcagatacggaggtgctgctgcacagctacattgaatggcaggaagactgtgtagaccat
ctcaatggcatattcgcttttgctgtgtgggatgaaaagcgcgatctgctgttcgctgcg
agagaccgtctcggtgtgaagccgtttttttacacgaagcaaggatcttcttttctcttc
gggtccgaaatcaaagcgatcctcgcacaccctgatataaaagcgcaagtggacagaaca
ggactttctgaaattttcgggcttggaccgtccagaaccccgggaagtggcgtatttaaa
ggcataaaagaagtccggccggctcacgcgctgacgttttctaaagacgggctgaatatt
tggcgttattggaatgttgaaagcgaaaaacatacggacagttttgatgacacggttgcc
aatgtcagatcgttgtttcaggatgcggtgacgcgacagcttgtgtcggatgtgccggtt
tgtacgttcctatcaggcggactggactcaagcgccattacagcgattgcagcaggccat
tttgaaaagggaggaaaagcaccacttcatacttattcgattgattacgaagagaacgat
aaattttttcaagcgagcgcttttcagccgaatgacgatgggccttggattgaaaaaatg
acagaggccttcggcacaacacaccacaaatgcgtcatcagccaaaagaatctcgtcgat
catttggaggaagccgtactggtcaaagacttgccgggaatggctgatgtcgactcgtct
ctgctgtggttttgccgggaaatcaaaaaggactttgtcgtcagcctgtcgggagagtgc
gcggatgagattttcggcgggtacccgtggttccatatggcagacgttgagtcgggcttt
ccatggatgagatcgacagaagagcggatcaagctgctttctgattcatggcagaaaaaa
ttgaatcttaaagaatacgtaaatgccaaatacgaagaaaccttggcggaaacgccatta
ttagatggagaaacgggtgtggacaaagcaagaagacagctgttctatttaaatatgctt
tggtttatgacgaaccttttggatcggaaggatcgcatgagcatgggggcgagccttgaa
gtgcgggtgccgttcgccgatcaccggctcgtggaatatgtttggaatatcccatgggaa
atgaaaatgcatgacaaccgggaaaaaggcattttgcgaaaagcgctcgagggcattttg
cctgatgacattctgtatcgcaaaaaaagcccatatccgaaaacacaccacccggaatat
acaaaaggcgtcagcgaatggctgaaaacgatcagaagccaaaaggactctgtgcttcat
acgctgctggacagaaaacaattggatcagctcttagaaacggaaggctcctccttcaag
gttccgtggttcgggcagctcatgaaggggcctcagctgatcgcccaccttgcccaaatt
catacatggtttgaagcgtatcgcattgatattgatgagggataa

DBGET integrated database retrieval system