KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_06225Help
Entry
BSUW23_06225      CDS       T01302                                 

Gene name
yjjA
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bss00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1251281..1252093
Genome map
AA seq 270 aa AA seqDB search
MGKGLHGKRVAIGGSRKTEEISTIIEKQGGTPVIRPLQGTVYLAEKQVEPDLRTFAEEKA
DWVIFTTGIGTETLVDMAEKIGLKDEFLQAIRQAKAACRGYKTLSALKKLGITPEASDED
GTTRGLIRSLEPYDFSGKTVMVQLHGENAPALIAFLEEKGASVLPILPYQHIPPEEETVE
RLCRELMNGEIDAVCFTTAIQVRSLFDFAKARGYIDEVKAVFEERAIAAAVGKVTAEALR
EEGITRLLAPEIERMGAMIVELSKYYEETE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagggttacatggaaagcgagtggcaatcgggggctcccgaaaaacggaagaa
atcagcacgatcattgaaaaacagggcggaactcctgtcatccggcctctccaaggcacg
gtttatctagcagagaagcaggtagagccggatttgcggacgtttgcggaggaaaaagct
gactgggtcattttcacgacaggcatcggcacggagactcttgtcgatatggcagagaaa
atcggtctgaaagacgagtttctgcaggccattcgccaagcgaaagcggcatgccgagga
tacaaaacgctgtctgcgttgaaaaagcttgggatcacaccggaagcttcggatgaagac
gggacaacaagaggcttaatccgttccttggaaccttacgacttttcaggaaaaacagtc
atggtgcagcttcatggagaaaatgcgccggccctcatagcatttcttgaagaaaagggc
gcgtctgtcctgccgatcctgccttatcagcacatcccgccagaggaggaaacggtggag
cggttatgccgggagctgatgaacggtgagatcgacgccgtttgttttacaacggcaatt
caggttcgttccctgtttgattttgccaaggcgcgcggctatatcgatgaagtgaaggct
gtatttgaagagcgggccatcgctgcggctgtcggaaaagtgactgctgaagcactgcgg
gaagaaggcatcacgagactgcttgcgccggagattgagcggatgggcgcgatgattgtt
gagttgtccaagtattatgaagaaacggaataa

DBGET integrated database retrieval system