KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_06225Help
Entry
BSUW23_06225      CDS       T01302                                 

Gene name
yjjA
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSUW23_06225 (yjjA)
Enzymes [BR:bss01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BSUW23_06225 (yjjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1251281..1252093
Genome map
AA seq 270 aa AA seqDB search
MGKGLHGKRVAIGGSRKTEEISTIIEKQGGTPVIRPLQGTVYLAEKQVEPDLRTFAEEKA
DWVIFTTGIGTETLVDMAEKIGLKDEFLQAIRQAKAACRGYKTLSALKKLGITPEASDED
GTTRGLIRSLEPYDFSGKTVMVQLHGENAPALIAFLEEKGASVLPILPYQHIPPEEETVE
RLCRELMNGEIDAVCFTTAIQVRSLFDFAKARGYIDEVKAVFEERAIAAAVGKVTAEALR
EEGITRLLAPEIERMGAMIVELSKYYEETE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagggttacatggaaagcgagtggcaatcgggggctcccgaaaaacggaagaa
atcagcacgatcattgaaaaacagggcggaactcctgtcatccggcctctccaaggcacg
gtttatctagcagagaagcaggtagagccggatttgcggacgtttgcggaggaaaaagct
gactgggtcattttcacgacaggcatcggcacggagactcttgtcgatatggcagagaaa
atcggtctgaaagacgagtttctgcaggccattcgccaagcgaaagcggcatgccgagga
tacaaaacgctgtctgcgttgaaaaagcttgggatcacaccggaagcttcggatgaagac
gggacaacaagaggcttaatccgttccttggaaccttacgacttttcaggaaaaacagtc
atggtgcagcttcatggagaaaatgcgccggccctcatagcatttcttgaagaaaagggc
gcgtctgtcctgccgatcctgccttatcagcacatcccgccagaggaggaaacggtggag
cggttatgccgggagctgatgaacggtgagatcgacgccgtttgttttacaacggcaatt
caggttcgttccctgtttgattttgccaaggcgcgcggctatatcgatgaagtgaaggct
gtatttgaagagcgggccatcgctgcggctgtcggaaaagtgactgctgaagcactgcgg
gaagaaggcatcacgagactgcttgcgccggagattgagcggatgggcgcgatgattgtt
gagttgtccaagtattatgaagaaacggaataa

DBGET integrated database retrieval system