KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_06720Help
Entry
BSUW23_06720      CDS       T01302                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSUW23_06720 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BSUW23_06720 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BSUW23_06720 (proB)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BSUW23_06720 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1337086..1338183
Genome map
AA seq 365 aa AA seqDB search
MKKQRIVVKIGSSSLTNSNGSIDEAKIREHVQAISLLKKAGHEMILITSGAVAAGFSSLG
YPSRPVTIKGKQAAAAVGQTLLMQQYMNQFKQYSLTPGQILLTRNDFSKRERYRNAYATI
MELLERGVIPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
NPEAKRFDYLPEITPELLGYAGSAGSKVGTGGMKSKLLAAQTALSLGVKVFIGTGSGEQK
LADILDGRGDGTYIGDKELSSVNNTRQWIQFHSPIAGEILIDAGAEEAMIHNGSSLLPAG
VVGVNGSFPKGAVVEVRGPGGVIGKGQTHYSSEEIMEAKGKRSNELDFERTFEVIHRNDW
VNLKD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaagaatagtagtgaaaataggaagcagttcgctcacgaatagcaacgga
agcattgatgaggcaaaaatcagagagcatgttcaagccatttcactgttgaagaaagcg
ggacatgaaatgattctgattacctcgggtgccgtagcggcggggttttccagcctcggt
tatccgtcccgacccgttaccattaaaggaaagcaggcggcggccgcggtcggacaaaca
ctgttaatgcagcaatatatgaatcaattcaaacaatactctctgactccgggacaaatc
cttttaacgagaaatgatttttcgaaaagagaacggtaccgaaacgcatatgcaacgata
atggaattactggagcgcggcgtcattccgattatcaatgaaaatgactctacatctgtt
gaagaattgacattcggggataatgacatgctttctgcgttagtcagcggattgattcat
gcggaccagctcatgattctcactgacattaacgggctgtatgatgccaatccgaatgaa
aatcctgaggcgaaacgatttgattatctgccggagatcacgcctgaattactgggatat
gcgggctcagccggatcaaaggtcggcaccggcggtatgaaatcaaagctgttagctgca
caaactgcgctgtctcttggagtgaaagtgtttatcggaacaggcagcggagagcaaaag
cttgcggatattttagacggcaggggagacggcacttatatcggagacaaagaattatcc
tcggttaacaacacgagacagtggattcagttccactcgccgatagcaggagagatcctc
attgatgcgggtgccgaggaggcgatgatccataacggaagcagcctgctgccggctggc
gtagtaggcgtaaatggaagctttccgaaaggggcggttgtggaagtcagaggaccgggc
ggcgtgatcggcaaaggccaaactcattactcctccgaggagattatggaggccaaaggc
aaacgaagtaatgaacttgattttgagagaacgtttgaggttattcataggaatgactgg
gtcaatttaaaagactag

DBGET integrated database retrieval system