KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_07510Help
Entry
BSUW23_07510      CDS       T01302                                 

Gene name
pdhC
Definition
pyruvate dehydrogenase (dihydrolipoamide acetyltransferase E2 subunit)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSUW23_07510 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_07510 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BSUW23_07510 (pdhC)
   00620 Pyruvate metabolism
    BSUW23_07510 (pdhC)
Enzymes [BR:bss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BSUW23_07510 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484345..1485673
Genome map
AA seq 442 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVDEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSEESDDAKTEAQVQSTAEAGQDVAKEEQAQEP
AKATGAGQQDQAEVDPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNG
GAQEAAPQETAAPQETAAKPAAAPAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTL
MDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTEEVVQ
KHYFNIGIAADTEKGLLVPVVKNADRKSVFEISDEINGLATKAREGKLAPAEMKGASCTI
TNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGAT
AQNALNHIKRLLNDPQLILMEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccagatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgtcaagcctaacgatgaggttgacgaagatgatgtactggctgaagtccaa
aatgataaagcagtagtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacggttgcaactgttggacaaacgatcattacgtttgatgcacctggt
tacgaagaccttcaatttaaaggcagcgaagagtcagatgatgcgaaaactgaagcacaa
gttcagtcaacagcagaagctggacaagacgttgcgaaagaagagcaagctcaagagcct
gcaaaagcaacaggcgcaggacagcaggatcaagctgaagttgacccgaacaaacgagtg
atcgctatgccttctgtacgtaaatatgctcgtgaaaaaggcgtagacatccgtaaagtt
actggttcaggcaacaacggacgtgttgtaaaagaagatatcgacagctttgtaaacgga
ggagcgcaagaagcagcgccgcaagaaacagctgcaccacaagaaacagctgctaaaccg
gctgctgcaccggctccagagggcgaattcccagaaacacgcgaaaaaatgagcggtatc
cgtaaagcaattgcgaaagcgatggttaactctaaacacacagctcctcacgtaacgtta
atggacgaagtggatgtaacaaaccttgttgcacatcgtaaacagttcaaacaggttgct
gctgatcaaggaatcaagctgacttacttgccttacgttgtaaaagctcttacatctgca
ctgaaaaaattccctgttttaaacacgtcaattgacgataaaacagaagaagtagtccaa
aaacattacttcaacatcggtatcgctgctgacactgaaaaaggcttgcttgtaccggtt
gtgaaaaatgcagatcgtaaatctgtctttgaaatttctgatgagatcaatggccttgca
acaaaagctcgtgaaggcaagcttgctccagctgaaatgaaaggcgcatcttgcacaatt
acaaacatcggttctgccggcggacaatggttcactccggttatcaaccatccagaagtt
gcgattcttggtatcggacgcattgcagaaaaagcgattgttcgtgatggcgaaatcgta
gcagctccagtcttagctctttctctcagcttcgaccaccgcatgatcgacggagcaact
gcgcaaaatgcattaaatcacatcaagcgtttactgaacgatccacaattaattttaatg
gaggcgtaa

DBGET integrated database retrieval system