KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_07510Help
Entry
BSUW23_07510      CDS       T01302                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase (dihydrolipoamide acetyltransferase E2 subunit)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00010  Glycolysis / Gluconeogenesis
bss00020  Citrate cycle (TCA cycle)
bss00620  Pyruvate metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01130  Biosynthesis of antibiotics
bss01200  Carbon metabolism
Module
bss_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_07510 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BSUW23_07510 (pdhC)
   00620 Pyruvate metabolism
    BSUW23_07510 (pdhC)
Enzymes [BR:bss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BSUW23_07510 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 DUF1533 DUF5077 DUF3597
Motif
Other DBs
NCBI-ProteinID: ADM37550
UniProt: E0U3X8
Position
1484345..1485673
Genome map
AA seq 442 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVDEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSEESDDAKTEAQVQSTAEAGQDVAKEEQAQEP
AKATGAGQQDQAEVDPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNG
GAQEAAPQETAAPQETAAKPAAAPAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTL
MDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTEEVVQ
KHYFNIGIAADTEKGLLVPVVKNADRKSVFEISDEINGLATKAREGKLAPAEMKGASCTI
TNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGAT
AQNALNHIKRLLNDPQLILMEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccagatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgtcaagcctaacgatgaggttgacgaagatgatgtactggctgaagtccaa
aatgataaagcagtagtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacggttgcaactgttggacaaacgatcattacgtttgatgcacctggt
tacgaagaccttcaatttaaaggcagcgaagagtcagatgatgcgaaaactgaagcacaa
gttcagtcaacagcagaagctggacaagacgttgcgaaagaagagcaagctcaagagcct
gcaaaagcaacaggcgcaggacagcaggatcaagctgaagttgacccgaacaaacgagtg
atcgctatgccttctgtacgtaaatatgctcgtgaaaaaggcgtagacatccgtaaagtt
actggttcaggcaacaacggacgtgttgtaaaagaagatatcgacagctttgtaaacgga
ggagcgcaagaagcagcgccgcaagaaacagctgcaccacaagaaacagctgctaaaccg
gctgctgcaccggctccagagggcgaattcccagaaacacgcgaaaaaatgagcggtatc
cgtaaagcaattgcgaaagcgatggttaactctaaacacacagctcctcacgtaacgtta
atggacgaagtggatgtaacaaaccttgttgcacatcgtaaacagttcaaacaggttgct
gctgatcaaggaatcaagctgacttacttgccttacgttgtaaaagctcttacatctgca
ctgaaaaaattccctgttttaaacacgtcaattgacgataaaacagaagaagtagtccaa
aaacattacttcaacatcggtatcgctgctgacactgaaaaaggcttgcttgtaccggtt
gtgaaaaatgcagatcgtaaatctgtctttgaaatttctgatgagatcaatggccttgca
acaaaagctcgtgaaggcaagcttgctccagctgaaatgaaaggcgcatcttgcacaatt
acaaacatcggttctgccggcggacaatggttcactccggttatcaaccatccagaagtt
gcgattcttggtatcggacgcattgcagaaaaagcgattgttcgtgatggcgaaatcgta
gcagctccagtcttagctctttctctcagcttcgaccaccgcatgatcgacggagcaact
gcgcaaaatgcattaaatcacatcaagcgtttactgaacgatccacaattaattttaatg
gaggcgtaa

DBGET integrated database retrieval system