KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_07960Help
Entry
BSUW23_07960      CDS       T01302                                 

Gene name
rluD
Definition
pseudouridylate synthase
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1572462..1573373
Genome map
AA seq 303 aa AA seqDB search
MNQIDITASEEQKSERIDKFLASTENDWSRTQVQQWVKDGQVVVNGSPVKSNYKIQPGDQ
VTVTVPEPEALDVLAEPMDLDIYYEDQDVLVVNKPRGMVVHPAPGHLTGTLVNGLMAHCT
DLSGINGVMRPGIVHRIDKDTSGLLMVAKNDMAHESLVNQLVNKTVTRKYTAVVHGLISH
DDGTIDAPIGRDKKDRQSMTVTRDGKNAVTHFHVLERFQDFTLVECQLETGRTHQIRVHM
KYIGFPLAGDPKYGPRKTIDFNGQALHAGILGFDHPRTGEYVEFEAPLPEDMAELIENLR
KND
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaattgatataaccgcttcagaagaacaaaaaagtgagcggattgataaattt
ctggcatcgactgagaatgattggtcgagaacacaggtgcagcaatgggtgaaagacgga
caagttgtcgtgaacggaagccctgtaaaatcgaattataaaattcagccgggggatcag
gtgaccgtcactgtgcctgagcctgaagcgctcgacgtgctggcagaacctatggatctg
gatatttactatgaagatcaggatgtgctggtcgtcaataaacctcgcggaatggttgtg
cacccagctcccgggcatcttacgggtacacttgtaaacggccttatggctcattgtacg
gacctttccggaataaatggcgtgatgcgtccggggatcgtccatagaatcgataaggac
acgtccggcttattaatggtggcgaagaatgatatggcgcacgagtcacttgtaaaccaa
ttggtcaacaaaacggtcacgcggaaatatacggcagttgtccatgggcttatttctcac
gatgacggcacaattgacgcgccgatcggacgggacaagaaagaccgtcaaagcatgact
gtgacgcgtgatggcaaaaatgccgtcactcattttcatgtgcttgagcgttttcaggat
tttacgttggtggaatgtcagcttgaaaccggaagaacgcatcaaattcgtgttcatatg
aaatatattggatttccattagccggcgatccaaaatacggtccgagaaaaacgatcgat
tttaacggtcaggcccttcacgccggtattttaggatttgatcatcctcgcactggcgaa
tatgtcgaatttgaagcgccgcttccggaggatatggcagaattaatcgaaaacctgaga
aaaaacgattga

DBGET integrated database retrieval system