KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_08525Help
Entry
BSUW23_08525      CDS       T01302                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00900  Terpenoid backbone biosynthesis
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01130  Biosynthesis of antibiotics
Module
bss_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSUW23_08525 (dxr)
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BSUW23_08525 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADM37751
UniProt: E0TUE4
Position
1679369..1680520
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTLDVLRTHQDQFQLVSMSFGRNIDKAVQMIEAFQPKFVSVGDLD
TYHKLKQMSFSFECQIGLGEEGLIEAAVMEEVDTVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKEHAKKYDVPLLPVDSEHSAIFQALQGEQAKNIERLIITASGGSFRD
KTREELESVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDKSVIAQLGTPDMRVPIQYALTYPDRLPLPDAKRLELWEIGSLHFEKAD
FDRFRCLQFAFESGKIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEKALSRHQLVK
KPSLADIQEVDKDTRGYVNSILT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatatttgtcttttaggagcaacaggatcaatcggcgaacagacactagatgta
cttcgtacacatcaagatcaatttcagctggtatctatgtcgtttggcagaaatatcgat
aaggccgttcaaatgatagaggcctttcagccgaagtttgtctctgtcggtgatctggat
acatatcataaattaaaacaaatgtctttttcttttgaatgccaaatcgggctgggagaa
gagggactgatagaagcagcagtgatggaggaggttgacaccgttgtcaacgccttgctc
ggaagtgtcggtcttatcccgacgttaaaggcaattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactcttgtcactgcagggcatatagtaaaagaacacgctaagaaatac
gatgttccgctgctgcctgttgacagtgagcattcggccatttttcaagcgctacaaggc
gaacaagctaaaaacattgaacgcctcatcattacggcatccggcggaagttttcgggac
aagacgcgggaggagctcgaatcagtaacggttgaggacgcattaaaacatccgaattgg
tcaatgggtgcaaaaattacgattgattcggctacaatgatgaataaggggttagaggtg
atcgaggcgcattggcttttcgatataccatatgaacaaattgatgtggttttacataag
gagagcatcatccattcaatggttgagttccatgacaaaagtgtgatcgcacagctcgga
actccggatatgagggttccaattcaatatgcgctcacttatcctgaccggttgccatta
ccagatgcgaaaaggcttgaattatgggaaatcggcagcctccattttgagaaagctgat
tttgacaggttccgctgcttacaatttgcttttgaatcaggtaaaataggaggaacaatg
ccaacagtgctaaatgcggcaaatgaagtagctgtcgctgcctttttagccggcaagata
ccgtttttggctattgaagactgtatcgaaaaggcactatcccgccatcagttagttaaa
aaaccgagcctggcggacattcaagaagtggacaaagatacccggggatacgtcaattca
atactcacataa

DBGET integrated database retrieval system