KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_09035Help
Entry
BSUW23_09035      CDS       T01302                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Brite
Enzymes [BR:bss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     BSUW23_09035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1849110..1849808
Genome map
AA seq 232 aa AA seqDB search
MKQKRMKFLLAVLCSLLLSLPAWSAQAATTITSNQTGSQDGYDYELWKDYGNTSMTLNSG
GAFSAQWSNIGNALFRKGKKFDTTKTHSELGNISINYNATFNPRGNSYLCVYGWTKDPLV
EYYIVDNWGTYRPTGTPKGTITVDGGTYDIYETTRINQPSIIGIATFKQYWSVRQTKRTS
GTVSVSEHFKKWESLGMPMGKMYETALTVEGYQSNGSANVSTNVLTIGGKSK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaaagaatgaagtttttgttagcagttttatgtagtctattgctgtcatta
cctgcatggtccgctcaggcggcaactacaatcacctcaaatcaaaccggctcccaagat
ggctacgactatgaattgtggaaggattatgggaacaccagtatgacgctcaatagcggc
ggcgcgtttagtgcccagtggagtaacattgggaatgctttattccgaaaaggcaagaaa
ttcgatacaaccaagactcactcagagcttggaaacatatcaattaattacaacgcaacc
ttcaatccgagaggaaattcctatctatgtgtttatggatggacgaaggatccgctcgta
gaatattatatcgtcgataattggggcacttatagaccgaccggtacgccaaagggtact
attactgttgatgggggcacatatgacatttatgagaccactcggatcaaccaaccttct
attataggtatcgcaacctttaaacagtattggagtgtccggcagacaaaacgaacgagc
ggaaccgtatctgtcagcgaacacttcaagaagtgggaaagcttaggaatgccaatgggt
aaaatgtatgaaaccgcgcttacggtagagggatatcaaagtaatggcagtgctaatgta
tctactaatgtactgactattggagggaaaagtaaataa

DBGET integrated database retrieval system