KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_09340Help
Entry
BSUW23_09340      CDS       T01302                                 

Gene name
yngB
Definition
UTP-sugar-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSUW23_09340 (yngB)
   00052 Galactose metabolism
    BSUW23_09340 (yngB)
   00500 Starch and sucrose metabolism
    BSUW23_09340 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    BSUW23_09340 (yngB)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSUW23_09340 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1895706..1896596
Genome map
AA seq 296 aa AA seqDB search
MKKIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIIEEAVQSGIEDILIITGRN
KRAIEDHFDRSIELEQNLIEKGKTDLLDEMQDIANLANIHYIRQKEPLGLGHAVLCAEHF
IGDEPFAVLLGDDIMVSETPALRQLMDVYNAYGTEVVGVQSVLPEDVSKYGIINTSGSHG
HVFEVKDLVEKPSPEEAPSEIAVMGRYVLNSSIFPVLKSIGRGAGNEIQLTDALREACRK
QPIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLAYLEDVIKRETKEMLR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagaaaagccgtcatccctgcagcaggtttaggaacacgttttttacct
gcaacgaaagctcagcctaaggaaatgctccctatcgttgataagcctgctattcaatat
attattgaggaagcggttcagtcaggtattgaagatattttgattattacagggcgaaat
aagcgagcgattgaagaccattttgaccgttccattgagcttgaacagaatttgattgaa
aaaggaaaaacagatctcttagacgagatgcaggacattgcaaatcttgcgaatatccat
tatattcgtcagaaggagccccttggattggggcatgccgttttgtgcgcagagcatttc
attggcgatgaaccgtttgccgtccttttaggcgatgatattatggtgtctgaaacaccg
gctcttcggcaattaatggatgtatacaatgcatatggtacagaggttgtcggtgtacag
tccgttctgcctgaggatgtcagcaaatatggtattatcaatacatcaggttctcacgga
catgtatttgaagtgaaagatttagtggaaaagccttctcctgaagaagcgccttcggaa
atcgccgtgatgggacgttatgtgctgaattcatcgatcttccccgttctaaagtccatt
ggcagaggcgcgggcaacgaaattcagcttacagatgcgcttcgtgaggcttgccgtaag
cagcctatccatgcccggctgctggaaggaaatcgatatgacattggcgataagctgggc
tgttttaaagcgagcactgaaatcggcttaatgagacccgaaatgagatctcagctttta
gcctatttagaagatgtgatcaaacgggaaacgaaagaaatgctgcgataa

DBGET integrated database retrieval system