KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_09830Help
Entry
BSUW23_09830      CDS       T01302                                 

Gene name
proJ
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00330  Arginine and proline metabolism
bss00332  Carbapenem biosynthesis
bss01100  Metabolic pathways
bss01130  Biosynthesis of antibiotics
bss01230  Biosynthesis of amino acids
Module
bss_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BSUW23_09830 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BSUW23_09830 (proJ)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BSUW23_09830 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADM38010
UniProt: E0TY10
Position
complement(2005747..2006862)
Genome map
AA seq 371 aa AA seqDB search
MTPDTNMKRVVVKIGSSSLTSLHGEISIRKLEALVDQVVKLKDAGYEVILVSSGAVAAGY
RKLGFIRRPEKLPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDEYRYNNV
RNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDG
NPRTNPEAKRMERVSEITPDIEACAGDTGSGVGTGGMRSKLDAFKIVMASGIKGFLGQAD
AGDILYQAVHEEAEGTYFEAEGTLPLNQKEQWIAFNSGPEGEMILSDDYSRKITNGQSCL
YLDGVQEIKGKFKSGSVVRLMDSQGAEIGLGIVNYSSVQLQEPDKKEELINKAVIDQEAF
VCHVNLSLPVN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcctgatacaaacatgaaaagagtcgttgtgaagattggaagcagttcattaaca
agccttcatggagaaatcagcattcgaaaattagaagcgctggtcgaccaagtcgtcaaa
ctcaaagacgccggctatgaagtgattttggtttcctcaggcgcagtggcggcgggatat
cggaagctcggatttatccgaagacccgaaaagcttccggaaaaacaagcatcagcctca
atcggccaaggcctgctgatggaagcttattcaaagctgtttttggcacacggctatgtt
gcatcccaaattttaattacgagaagcgatttttctgatgaatatcggtataacaatgtc
cggaatacaatgaatgtactcctcgaacgcggcatcatcccgattatcaacgaaaatgat
acagttaccgtcaatcggctcaaatttggcgacaatgatacgctcgcagcaaaagtcgcc
ggattaattgatgcagatatgcttgtgattttatcagatatcgacggtttatatgacgga
aatccgcgtacaaatccagaagcgaaaaggatggagcgggtaagtgaaataacgcctgac
attgaagcgtgtgcaggtgacactggcagcggcgtcggcactggcggtatgcgctctaag
cttgatgcgtttaaaatcgtaatggcatccggaattaaaggatttctcggtcaggcagat
gccggcgatattttatatcaagccgttcatgaagaagcggaaggcacctattttgaagca
gagggaacgcttccgttgaatcaaaaggagcagtggatcgcttttaattccggcccggaa
ggtgaaatgattttatcagatgattattcccgaaaaataacaaacggccaatcgtgtcta
tatctggacggtgtacaggagattaaaggaaaattcaaaagcggatcagttgttcggctg
atggattcacaaggggcagaaatcgggctcggaattgtcaattattcttctgtacagctt
caagaaccggataagaaggaagaattgataaacaaagctgtgatagatcaggaagcattt
gtttgccatgtgaatttatctttgcctgtcaattaa

DBGET integrated database retrieval system